* | S | 80.0 |
# | T | 80.0 |
@ | K | 12.0 |
Static | C | 57.0 |
true | Use criteria |
0.0 | Minimum peptide confidence |
0.05 | Peptide false positive rate |
0.0 | Minimum protein confidence |
1.0 | Protein false positive rate |
1 | Minimum charge state |
16 | Maximum charge state |
0.0 | Minimum ion proportion |
1000 | Maximum Sp rank |
-1.0 | Minimum Sp score |
Include | Modified peptide inclusion |
Any | Tryptic status requirement |
false | Multiple, ambiguous IDs allowed |
Ignore | Peptide validation handling |
XCorr | Purge duplicate peptides by protein |
false | Include only loci with unique peptide |
true | Remove subset proteins |
Ignore | Locus validation handling |
0 | Minimum modified peptides per locus |
1000 | Minimum redundancy for low coverage loci |
2 | Minimum peptides per locus |
Validation Status | Locus | Sequence Count | Spectrum Count | Sequence Coverage | Length | MolWt | pI | Descriptive Name |
Locus | # of identical peptides | # of differing peptides |
U | gi|73623035|ref|NP_00 | 100 | 646 | 66.1% | 1193 | 134422 | 5.0 | sperm-associated antigen 5 [Homo sapiens] &IC Astrin |
U | gi|83267868|ref|NP_00 | 8 | 18 | 59.6% | 89 | 10366 | 7.4 | dynein light chain 1, cytoplasmic [Homo sapiens] &IC LC8-type 1 |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.07411.07411.2 | 3.3208 | 0.3042 | 100.0% | 1415.1122 | 1415.6322 | 2 | 6.564 | 68.2% | 1 | K.YNIEKDIAAHIK.K | 2 |
* | Astrin_STLC_112116_tube2_01.07367.07367.3 | 3.0692 | 0.3069 | 99.6% | 1415.4543 | 1415.6322 | 63 | 5.216 | 43.2% | 2 | K.YNIEKDIAAHIK.K | 3 |
* | Astrin_STLC_112116_tube2_01.06610.06610.2 | 2.9763 | 0.3137 | 100.0% | 1543.1721 | 1543.8064 | 1 | 6.453 | 58.3% | 1 | K.YNIEKDIAAHIKK.E | 2 |
* | Astrin_STLC_112116_tube2_01.06604.06604.3 | 3.2011 | 0.3332 | 99.8% | 1543.4944 | 1543.8064 | 1 | 5.275 | 50.0% | 1 | K.YNIEKDIAAHIKK.E | 3 |
Astrin_STLC_112116_01.06027.06027.2 | 2.561 | 0.3843 | 100.0% | 1402.8121 | 1403.5493 | 3 | 5.913 | 65.0% | 1 | K.YNPTWHCIVGR.N | 22 | |
Astrin_STLC_112116_tube2_01.04588.04588.2 | 3.1401 | 0.4414 | 100.0% | 1282.9122 | 1283.383 | 1 | 7.567 | 75.0% | 2 | R.NFGSYVTHETK.H | 22 | |
Astrin_STLC_112116_tube2_01.15164.15164.3 | 5.9399 | 0.494 | 100.0% | 3236.6943 | 3237.771 | 1 | 9.774 | 37.5% | 6 | R.NFGSYVTHETKHFIYFYLGQVAILLFK.S | 33 | |
Astrin_STLC_112116_tube2_02.13478.13478.3 | 4.4142 | 0.4062 | 100.0% | 3380.4543 | 3381.9011 | 2 | 6.475 | 25.0% | 4 | R.NFGSYVTHETKHFIYFYLGQVAILLFKSG.- | 33 |
U | gi|18087855|ref|NP_54 | 5 | 14 | 59.6% | 89 | 10350 | 7.4 | dynein light chain 2, cytoplasmic [Homo sapiens] &IC LC8-type 2 |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.08310.08310.3 | 3.7441 | 0.3469 | 99.8% | 1570.1344 | 1569.8412 | 1 | 6.229 | 47.9% | 1 | K.YNIEKDIAAYIKK.E | 3 |
Astrin_STLC_112116_01.06027.06027.2 | 2.561 | 0.3843 | 100.0% | 1402.8121 | 1403.5493 | 3 | 5.913 | 65.0% | 1 | K.YNPTWHCIVGR.N | 22 | |
Astrin_STLC_112116_tube2_01.04588.04588.2 | 3.1401 | 0.4414 | 100.0% | 1282.9122 | 1283.383 | 1 | 7.567 | 75.0% | 2 | R.NFGSYVTHETK.H | 22 | |
Astrin_STLC_112116_tube2_01.15164.15164.3 | 5.9399 | 0.494 | 100.0% | 3236.6943 | 3237.771 | 1 | 9.774 | 37.5% | 6 | R.NFGSYVTHETKHFIYFYLGQVAILLFK.S | 33 | |
Astrin_STLC_112116_tube2_02.13478.13478.3 | 4.4142 | 0.4062 | 100.0% | 3380.4543 | 3381.9011 | 2 | 6.475 | 25.0% | 4 | R.NFGSYVTHETKHFIYFYLGQVAILLFKSG.- | 33 |
U | contaminant_KERATIN09 | 18 | 56 | 55.5% | 429 | 47927 | 5.5 | no description |
U | gi|226530908|ref|NP_0 | 18 | 87 | 51.9% | 285 | 30315 | 7.5 | protein-L-isoaspartate(D-aspartate) O-methyltransferase isoform 1 [Homo sapiens] |
U | gi|354983493|ref|NP_0 | 18 | 87 | 51.7% | 286 | 30358 | 6.7 | protein-L-isoaspartate(D-aspartate) O-methyltransferase isoform 2 [Homo sapiens] |
U | contaminant_KERATIN21 | 14 | 21 | 48.2% | 357 | 39219 | 5.2 | no description |
U | gi|119395750|ref|NP_0 | 40 | 126 | 48.1% | 644 | 66039 | 8.1 | keratin, type II cytoskeletal 1 [Homo sapiens] |
U | gi|29788785|ref|NP_82 | 15 | 83 | 48.0% | 444 | 49671 | 4.9 | tubulin beta chain isoform b [Homo sapiens] |
U | gi|645912968|ref|NP_0 | 15 | 83 | 45.9% | 464 | 52018 | 5.0 | tubulin beta chain isoform a [Homo sapiens] |
U | contaminant_KERATIN20 | 26 | 58 | 47.6% | 483 | 53748 | 5.4 | no description |
U | gi|24430192|ref|NP_00 | 21 | 47 | 46.1% | 473 | 51268 | 5.0 | keratin, type I cytoskeletal 16 [Homo sapiens] |
U | contaminant_KERATIN02 | 23 | 71 | 45.5% | 622 | 61987 | 5.2 | no description |
U | gi|55956899|ref|NP_00 | 23 | 71 | 45.4% | 623 | 62064 | 5.2 | keratin, type I cytoskeletal 9 [Homo sapiens] |
U | gi|10800130|ref|NP_06 | 4 | 11 | 43.8% | 130 | 14107 | 10.9 | histone H2A type 1-D [Homo sapiens] |
U | gi|4504249|ref|NP_003 | 4 | 11 | 43.8% | 130 | 14091 | 10.9 | histone H2A type 1 [Homo sapiens] |
U | gi|29553970|ref|NP_80 | 4 | 11 | 44.2% | 129 | 14019 | 10.9 | histone H2A.J [Homo sapiens] |
U | gi|18105045|ref|NP_54 | 4 | 11 | 44.5% | 128 | 13906 | 10.9 | histone H2A type 1-H [Homo sapiens] |
U | gi|10800144|ref|NP_06 | 4 | 11 | 44.5% | 128 | 13936 | 10.9 | histone cluster 1, H2aj [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.07633.07633.2 | 2.54 | 0.345 | 100.0% | 945.33215 | 945.1093 | 131 | 6.211 | 62.5% | 2 | R.AGLQFPVGR.V | 222 | |
Astrin_STLC_112116_01.15848.15848.3 | 6.0609 | 0.5426 | 100.0% | 2917.6143 | 2917.3752 | 1 | 9.275 | 33.9% | 3 | R.VGAGAPVYLAAVLEYLTAEILELAGNAAR.D | 3 | |
Astrin_STLC_112116_01.15850.15850.2 | 4.316 | 0.4432 | 100.0% | 2918.0923 | 2917.3752 | 1 | 6.692 | 37.5% | 2 | R.VGAGAPVYLAAVLEYLTAEILELAGNAAR.D | 2 | |
Astrin_STLC_112116_tube2_01.11897.11897.2 | 4.762 | 0.4629 | 100.0% | 1932.4321 | 1932.3573 | 1 | 8.027 | 58.3% | 4 | K.VTIAQGGVLPNIQAVLLPK.K | 22 |
U | gi|106775678|ref|NP_0 | 4 | 11 | 43.8% | 130 | 14095 | 10.9 | histone H2A type 2-A [Homo sapiens] |
U | gi|24638446|ref|NP_00 | 4 | 11 | 44.2% | 129 | 13988 | 10.9 | histone H2A type 2-C [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.07633.07633.2 | 2.54 | 0.345 | 100.0% | 945.33215 | 945.1093 | 131 | 6.211 | 62.5% | 2 | R.AGLQFPVGR.V | 222 | |
Astrin_STLC_112116_tube2_01.16255.16255.2 | 3.4191 | 0.5492 | 100.0% | 2933.7922 | 2935.4082 | 1 | 8.478 | 41.1% | 2 | R.VGAGAPVYMAAVLEYLTAEILELAGNAAR.D | 2 | |
Astrin_STLC_112116_01.15752.15752.3 | 4.1268 | 0.3966 | 99.8% | 2934.0544 | 2935.4082 | 3 | 7.152 | 26.8% | 3 | R.VGAGAPVYMAAVLEYLTAEILELAGNAAR.D | 3 | |
Astrin_STLC_112116_tube2_01.11897.11897.2 | 4.762 | 0.4629 | 100.0% | 1932.4321 | 1932.3573 | 1 | 8.027 | 58.3% | 4 | K.VTIAQGGVLPNIQAVLLPK.K | 22 |
U | gi|16507237|ref|NP_00 | 21 | 45 | 43.1% | 654 | 72333 | 5.2 | 78 kDa glucose-regulated protein precursor [Homo sapiens] |
U | gi|57013276|ref|NP_00 | 16 | 58 | 42.8% | 451 | 50152 | 5.1 | tubulin alpha-1B chain [Homo sapiens] |
U | gi|20127519|ref|NP_03 | 34 | 78 | 42.2% | 747 | 85653 | 9.2 | targeting protein for Xklp2 [Homo sapiens] |
U | gi|15431310|ref|NP_00 | 21 | 38 | 42.2% | 472 | 51622 | 5.2 | keratin, type I cytoskeletal 14 [Homo sapiens] |
U | gi|57242777|ref|NP_03 | 5 | 12 | 41.7% | 103 | 11967 | 5.9 | C-Myc-binding protein [Homo sapiens] &IC MYCBP |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.06940.06940.2 | 2.775 | 0.3415 | 100.0% | 934.0122 | 934.07764 | 6 | 5.819 | 68.8% | 2 | K.SGVLDTLTK.V | 2 |
* | Astrin_STLC_112116_tube2_01.10514.10514.2 | 4.7076 | 0.4352 | 100.0% | 2276.3323 | 2276.6348 | 1 | 7.043 | 47.4% | 2 | K.VLVALYEEPEKPNSALDFLK.H | 2 |
* | Astrin_STLC_112116_tube2_01.10502.10502.3 | 4.3278 | 0.4241 | 100.0% | 2276.8442 | 2276.6348 | 1 | 7.193 | 36.8% | 2 | K.VLVALYEEPEKPNSALDFLK.H | 3 |
* | Astrin_STLC_112116_01.04863.04863.2 | 3.3519 | 0.307 | 100.0% | 1331.7922 | 1332.4528 | 5 | 5.136 | 65.0% | 5 | K.LAQYEPPQEEK.R | 2 |
* | Astrin_STLC_112116_tube2_01.04074.04074.2 | 3.268 | 0.2793 | 100.0% | 1687.9521 | 1688.8345 | 1 | 5.922 | 61.5% | 1 | K.LAQYEPPQEEKRAE.- | 2 |
U | contaminant_gi|746301 | 10 | 115 | 40.1% | 269 | 27961 | 6.7 | lysyl endopeptidase (EC 3.4.21.50) - Lysobacter enzymogenes &IC Lys-C |
U | gi|14389309|ref|NP_11 | 16 | 58 | 39.2% | 449 | 49895 | 5.1 | tubulin alpha-1C chain isoform c [Homo sapiens] |
U | gi|733606247|ref|NP_0 | 16 | 58 | 42.5% | 414 | 46057 | 5.1 | tubulin alpha-1C chain isoform b [Homo sapiens] |
U | gi|733605926|ref|NP_0 | 16 | 60 | 33.9% | 519 | 57730 | 5.1 | tubulin alpha-1C chain isoform a [Homo sapiens] |
U | gi|25777713|ref|NP_73 | 4 | 6 | 38.7% | 163 | 18658 | 4.5 | S-phase kinase-associated protein 1 isoform b [Homo sapiens] &IC Skp1A |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_02.09296.09296.2 | 3.3066 | 0.3792 | 100.0% | 1880.3922 | 1880.0588 | 1 | 6.813 | 53.1% | 1 | K.LQSSDGEIFEVDVEIAK.Q | 2 | |
Astrin_STLC_112116_tube2_01.10840.10840.3 | 4.2498 | 0.4347 | 100.0% | 3126.8643 | 3127.5056 | 1 | 7.224 | 29.5% | 2 | K.TMLEDLGMDDEGDDDPVPLPNVNAAILKK.V | 3 | |
* | Astrin_STLC_112116_tube2_02.08269.08269.3 | 4.6736 | 0.3849 | 100.0% | 2071.4644 | 2071.2078 | 1 | 7.304 | 53.1% | 2 | K.TFNIKNDFTEEEEAQVR.K | 3 |
* | Astrin_STLC_112116_tube2_01.05715.05715.2 | 2.6896 | 0.3594 | 100.0% | 1466.8722 | 1467.4888 | 3 | 6.357 | 59.1% | 1 | K.NDFTEEEEAQVR.K | 2 |
U | gi|4758792|ref|NP_004 | 3 | 3 | 38.7% | 124 | 13712 | 8.3 | NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial precursor [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_01.04005.04005.3 | 2.9186 | 0.2666 | 98.6% | 1697.3944 | 1697.8015 | 1 | 4.727 | 40.4% | 1 | K.VTHTGQVYDDKDYR.R | 3 |
* | Astrin_STLC_112116_tube2_02.09346.09346.3 | 4.5837 | 0.3804 | 100.0% | 2759.3643 | 2760.03 | 7 | 5.626 | 29.3% | 1 | R.QKEVNENFAIDLIAEQPVSEVETR.V | 3 |
* | Astrin_STLC_112116_tube2_01.04892.04892.2 | 2.9405 | 0.1095 | 97.6% | 1222.8922 | 1223.4117 | 1 | 5.359 | 88.9% | 1 | K.VYINLDKETK.T | 2 |
U | gi|316659409|ref|NP_0 | 9 | 22 | 36.8% | 375 | 41793 | 5.5 | actin, cytoplasmic 2 [Homo sapiens] |
U | gi|4501885|ref|NP_001 | 9 | 22 | 36.8% | 375 | 41737 | 5.5 | actin, cytoplasmic 1 [Homo sapiens] |
U | gi|5729877|ref|NP_006 | 24 | 51 | 36.1% | 646 | 70898 | 5.5 | heat shock cognate 71 kDa protein isoform 1 [Homo sapiens] |
U | gi|218505827|ref|NP_1 | 14 | 61 | 36.1% | 316 | 35438 | 6.3 | small kinetochore-associated protein isoform a [Homo sapiens] &IC SKAP |
U | gi|38016907|ref|NP_93 | 3 | 9 | 35.8% | 123 | 13475 | 8.0 | erythrocyte band 7 integral membrane protein isoform b [Homo sapiens] |
U | gi|38016911|ref|NP_00 | 3 | 9 | 15.3% | 288 | 31731 | 7.9 | erythrocyte band 7 integral membrane protein isoform a [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_01.04952.04952.2 | 3.3167 | 0.422 | 100.0% | 1247.9722 | 1248.3966 | 1 | 7.422 | 77.3% | 4 | K.VIAAEGEMNASR.A | 2 | |
Astrin_STLC_112116_tube2_01.07894.07894.2 | 2.3124 | 0.3449 | 99.5% | 1351.9722 | 1352.5707 | 10 | 4.837 | 59.1% | 1 | R.YLQTLTTIAAEK.N | 2 | |
Astrin_STLC_112116_tube2_01.15144.15144.2 | 3.6184 | 0.4188 | 100.0% | 2127.5322 | 2128.5781 | 1 | 6.774 | 50.0% | 4 | K.NSTIVFPLPIDMLQGIIGAK.H | 2 |
U | gi|119703753|ref|NP_0 | 17 | 32 | 35.6% | 564 | 60067 | 8.0 | keratin, type II cytoskeletal 6B [Homo sapiens] |
U | contaminant_KERATIN13 | 32 | 100 | 34.5% | 643 | 65494 | 6.6 | no description |
U | gi|5174735|ref|NP_006 | 11 | 49 | 34.4% | 445 | 49831 | 4.9 | tubulin beta-4B chain [Homo sapiens] |
U | gi|34098946|ref|NP_00 | 7 | 13 | 33.6% | 324 | 35924 | 9.9 | nuclease-sensitive element-binding protein 1 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_02.07159.07159.2 | 4.7364 | 0.5548 | 100.0% | 1797.1522 | 1796.8822 | 1 | 9.886 | 68.8% | 2 | R.SVGDGETVEFDVVEGEK.G | 2 | |
* | Astrin_STLC_112116_02.07579.07579.3 | 5.0202 | 0.5018 | 100.0% | 3473.6042 | 3474.7168 | 1 | 8.439 | 22.9% | 1 | R.SVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSK.Y | 3 |
* | Astrin_STLC_112116_tube2_01.04560.04560.2 | 4.8595 | 0.5046 | 100.0% | 1696.0521 | 1696.8577 | 1 | 9.394 | 61.1% | 2 | K.GAEAANVTGPGGVPVQGSK.Y | 2 |
* | Astrin_STLC_112116_01.04114.04114.3 | 6.0986 | 0.5093 | 100.0% | 3258.1743 | 3259.2566 | 1 | 9.02 | 33.9% | 2 | R.NYQQNYQNSESGEKNEGSESAPEGQAQQR.R | 3 |
* | Astrin_STLC_112116_01.03654.03654.3 | 4.7891 | 0.3581 | 100.0% | 2628.6243 | 2629.5835 | 1 | 6.824 | 38.6% | 1 | R.EDGNEEDKENQGDETQGQQPPQR.R | 3 |
* | Astrin_STLC_112116_01.03594.03594.3 | 2.8056 | 0.408 | 99.7% | 2784.4744 | 2785.771 | 1 | 5.874 | 29.3% | 2 | R.EDGNEEDKENQGDETQGQQPPQRR.Y | 3 |
* | Astrin_STLC_112116_01.04265.04265.2 | 3.4456 | 0.5384 | 100.0% | 1898.0721 | 1898.8914 | 10 | 8.864 | 39.5% | 3 | K.AADPPAENSSAPEAEQGGAE.- | 2 |
U | gi|62414289|ref|NP_00 | 15 | 16 | 33.3% | 466 | 53652 | 5.1 | vimentin [Homo sapiens] |
U | gi|20357599|ref|NP_61 | 2 | 4 | 33.3% | 114 | 12146 | 10.5 | histone H2A.V isoform 2 [Homo sapiens] |
U | gi|6912616|ref|NP_036 | 2 | 4 | 29.7% | 128 | 13509 | 10.6 | histone H2A.V isoform 1 [Homo sapiens] |
U | gi|4504255|ref|NP_002 | 2 | 4 | 29.7% | 128 | 13553 | 10.6 | histone H2A.Z [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.07633.07633.2 | 2.54 | 0.345 | 100.0% | 945.33215 | 945.1093 | 131 | 6.211 | 62.5% | 2 | R.AGLQFPVGR.I | 222 | |
Astrin_STLC_112116_01.15428.15428.3 | 5.8982 | 0.5232 | 100.0% | 2896.9443 | 2897.2952 | 5 | 9.75 | 25.9% | 2 | R.VGATAAVYSAAILEYLTAEVLELAGNASK.D | 3 |
U | contaminant_KERATIN12 | 16 | 24 | 33.2% | 431 | 47974 | 5.0 | no description |
U | gi|156564363|ref|NP_5 | 13 | 29 | 32.9% | 450 | 49960 | 5.1 | tubulin alpha-3C/D chain [Homo sapiens] |
U | contaminant_KERATIN18 | 16 | 23 | 32.2% | 562 | 59822 | 8.0 | no description |
U | gi|34932414|ref|NP_03 | 13 | 28 | 32.1% | 471 | 54232 | 8.9 | non-POU domain-containing octamer-binding protein isoform 1 [Homo sapiens] |
U | gi|5031839|ref|NP_005 | 16 | 25 | 30.9% | 564 | 60045 | 8.0 | keratin, type II cytoskeletal 6C [Homo sapiens] |
U | gi|222352151|ref|NP_0 | 7 | 10 | 30.1% | 356 | 37498 | 7.1 | poly(rC)-binding protein 1 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_01.04785.04785.2 | 2.6149 | 0.3304 | 100.0% | 1288.6921 | 1289.3538 | 1 | 6.269 | 70.0% | 1 | R.INISEGNCPER.I | 22 | |
* | Astrin_STLC_112116_01.08892.08892.2 | 3.2241 | 0.3189 | 100.0% | 1390.4722 | 1389.6781 | 1 | 6.69 | 70.8% | 2 | R.IITLTGPTNAIFK.A | 2 |
* | Astrin_STLC_112116_01.11927.11927.3 | 4.3826 | 0.3701 | 99.8% | 3379.5244 | 3380.8562 | 1 | 6.072 | 34.2% | 1 | K.AFAMIIDKLEEDINSSMTNSTAASRPPVTLR.L | 3 |
Astrin_STLC_112116_tube2_01.07200.07200.2 | 5.4171 | 0.5695 | 100.0% | 2089.9722 | 2091.2573 | 1 | 9.631 | 57.9% | 1 | R.ESTGAQVQVAGDMLPNSTER.A | 22 | |
* | Astrin_STLC_112116_01.04191.04191.2 | 2.4349 | 0.3014 | 99.3% | 1088.2122 | 1087.1777 | 7 | 4.999 | 65.0% | 1 | K.IANPVEGSSGR.Q | 2 |
* | Astrin_STLC_112116_02.09976.09976.3 | 4.8351 | 0.3444 | 99.7% | 2178.1443 | 2178.4937 | 1 | 7.211 | 36.2% | 2 | R.QVTITGSAASISLAQYLINAR.L | 3 |
* | Astrin_STLC_112116_02.09935.09935.2 | 5.8485 | 0.5371 | 100.0% | 2178.5122 | 2178.4937 | 1 | 10.526 | 62.5% | 2 | R.QVTITGSAASISLAQYLINAR.L | 2 |
U | gi|167466173|ref|NP_0 | 15 | 34 | 30.0% | 641 | 70052 | 5.6 | heat shock 70 kDa protein 1B [Homo sapiens] |
U | gi|194248072|ref|NP_0 | 15 | 34 | 30.0% | 641 | 70052 | 5.6 | heat shock 70 kDa protein 1A [Homo sapiens] |
U | gi|17921989|ref|NP_00 | 11 | 26 | 29.5% | 448 | 49924 | 5.1 | tubulin alpha-4A chain isoform 1 [Homo sapiens] |
U | gi|514052659|ref|NP_0 | 11 | 26 | 30.5% | 433 | 48329 | 5.0 | tubulin alpha-4A chain isoform 2 [Homo sapiens] |
U | gi|4504301|ref|NP_003 | 3 | 8 | 29.1% | 103 | 11367 | 11.4 | histone H4 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.05146.05146.2 | 2.8649 | 0.2403 | 99.5% | 1325.9321 | 1326.5387 | 1 | 4.99 | 77.3% | 1 | R.DNIQGITKPAIR.R | 2 |
* | Astrin_STLC_112116_tube2_01.07029.07029.2 | 3.7081 | 0.39 | 100.0% | 1181.0922 | 1181.3312 | 1 | 6.606 | 77.8% | 6 | R.ISGLIYEETR.G | 2 |
* | Astrin_STLC_112116_tube2_01.08642.08642.2 | 2.994 | 0.2987 | 100.0% | 989.9122 | 990.19055 | 2 | 5.09 | 85.7% | 1 | K.VFLENVIR.D | 2 |
U | gi|36287110|ref|NP_91 | 9 | 18 | 29.0% | 379 | 40907 | 4.6 | FGFR1 oncogene partner isoform b [Homo sapiens] |
U | gi|5901954|ref|NP_008 | 9 | 18 | 27.6% | 399 | 43065 | 4.8 | FGFR1 oncogene partner isoform a [Homo sapiens] |
U | gi|4758302|ref|NP_004 | 3 | 4 | 28.8% | 104 | 12259 | 5.9 | enhancer of rudimentary homolog [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.03598.03598.2 | 2.6215 | 0.2434 | 99.8% | 1105.7922 | 1106.2848 | 38 | 5.019 | 71.4% | 1 | K.MYEEHLKR.M | 2 |
* | Astrin_STLC_112116_01.06022.06022.2 | 3.688 | 0.3632 | 100.0% | 1871.2722 | 1872.0441 | 2 | 6.082 | 50.0% | 2 | R.ADTQTYQPYNKDWIK.E | 2 |
* | Astrin_STLC_112116_tube2_01.06198.06198.2 | 2.2091 | 0.1617 | 95.7% | 932.3722 | 933.185 | 161 | 4.604 | 66.7% | 1 | K.IYVLLRR.Q | 2 |
U | gi|31542947|ref|NP_00 | 12 | 25 | 28.4% | 573 | 61055 | 5.9 | 60 kDa heat shock protein, mitochondrial [Homo sapiens] |
U | gi|20149594|ref|NP_03 | 15 | 31 | 27.6% | 724 | 83264 | 5.0 | heat shock protein HSP 90-beta isoform a [Homo sapiens] &IC Hsp90 |
U | gi|431822408|ref|NP_0 | 15 | 31 | 28.0% | 714 | 82320 | 5.1 | heat shock protein HSP 90-beta isoform c [Homo sapiens] &IC Hsp90 |
U | contaminant_KERATIN03 | 15 | 22 | 27.2% | 593 | 59519 | 5.2 | no description |
U | gi|195972866|ref|NP_0 | 15 | 22 | 27.6% | 584 | 58801 | 5.2 | keratin, type I cytoskeletal 10 [Homo sapiens] |
U | gi|4506671|ref|NP_000 | 2 | 11 | 27.0% | 115 | 11665 | 4.5 | 60S acidic ribosomal protein P2 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.11055.11055.2 | 4.7409 | 0.3875 | 100.0% | 1870.3121 | 1870.1124 | 1 | 8.689 | 58.3% | 2 | R.YVASYLLAALGGNSSPSAK.D | 2 |
* | Astrin_STLC_112116_tube2_01.09552.09552.2 | 3.6703 | 0.5248 | 100.0% | 1256.9122 | 1257.4294 | 1 | 8.821 | 81.8% | 9 | K.NIEDVIAQGIGK.L | 2 |
U | gi|5901926|ref|NP_008 | 3 | 7 | 26.0% | 227 | 26227 | 8.8 | cleavage and polyadenylation specificity factor subunit 5 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.05289.05289.3 | 2.8896 | 0.212 | 96.9% | 1490.4243 | 1490.7428 | 9 | 4.835 | 43.2% | 1 | K.YIQQTKPLTLER.T | 3 |
* | Astrin_STLC_112116_tube2_01.06951.06951.3 | 3.1163 | 0.2758 | 99.3% | 1909.6144 | 1910.0911 | 1 | 5.059 | 35.3% | 1 | K.LPGGELNPGEDEVEGLKR.L | 3 |
* | Astrin_STLC_112116_tube2_01.14884.14884.3 | 5.1223 | 0.4806 | 100.0% | 3115.7344 | 3116.6274 | 1 | 8.505 | 33.9% | 5 | K.LVAAPLFELYDNAPGYGPIISSLPQLLSR.F | 3 |
U | gi|4504517|ref|NP_001 | 4 | 10 | 25.9% | 205 | 22783 | 6.4 | heat shock protein beta-1 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.09676.09676.2 | 3.4257 | 0.3748 | 100.0% | 1164.0922 | 1164.3494 | 1 | 6.876 | 94.4% | 6 | R.LFDQAFGLPR.L | 2 |
* | Astrin_STLC_112116_01.05586.05586.2 | 2.2872 | 0.2001 | 95.7% | 1076.1322 | 1076.1948 | 8 | 4.768 | 61.1% | 1 | R.QLSSGVSEIR.H | 2 |
* | Astrin_STLC_112116_tube2_01.08547.08547.3 | 3.0488 | 0.2585 | 98.6% | 1786.0144 | 1785.0068 | 117 | 5.214 | 31.7% | 1 | R.VSLDVNHFAPDELTVK.T | 3 |
* | Astrin_STLC_112116_01.07258.07258.2 | 4.527 | 0.4529 | 100.0% | 1907.6522 | 1907.1307 | 1 | 8.394 | 46.9% | 2 | K.LATQSNEITIPVTFESR.A | 2 |
U | gi|28875797|ref|NP_05 | 4 | 5 | 25.8% | 248 | 26397 | 12.2 | chromatin target of PRMT1 protein isoform 1 [Homo sapiens] |
U | gi|951880973|ref|NP_0 | 4 | 5 | 31.7% | 202 | 21918 | 12.0 | chromatin target of PRMT1 protein isoform 4 [Homo sapiens] |
U | gi|331028739|ref|NP_0 | 4 | 5 | 25.7% | 249 | 26525 | 12.2 | chromatin target of PRMT1 protein isoform 2 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_01.04268.04268.2 | 4.0976 | 0.3904 | 100.0% | 1446.8121 | 1447.6091 | 1 | 7.7 | 70.8% | 1 | R.ASMQQQQQLASAR.N | 2 | |
Astrin_STLC_112116_tube2_01.05287.05287.3 | 3.3332 | 0.3772 | 99.8% | 1784.9644 | 1785.0715 | 1 | 6.336 | 40.0% | 2 | R.LAQQMENRPSVQAALK.L | 3 | |
Astrin_STLC_112116_tube2_01.08006.08006.2 | 3.3069 | 0.3878 | 100.0% | 1555.2122 | 1555.6997 | 1 | 6.327 | 62.5% | 1 | K.EQLDNQLDAYMSK.T | 2 | |
Astrin_STLC_112116_tube2_02.08518.08518.3 | 2.979 | 0.2965 | 98.8% | 2436.7744 | 2436.566 | 2 | 4.515 | 28.6% | 1 | K.TKGHLDAELDAYMAQTDPETND.- | 3 |
U | gi|12667788|ref|NP_00 | 36 | 56 | 25.4% | 1960 | 226530 | 5.6 | myosin-9 [Homo sapiens] |
U | gi|17986258|ref|NP_06 | 4 | 10 | 25.2% | 151 | 16930 | 4.7 | myosin light polypeptide 6 isoform 1 [Homo sapiens] |
U | gi|88999583|ref|NP_52 | 4 | 10 | 25.2% | 151 | 16961 | 4.6 | myosin light polypeptide 6 isoform 2 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_01.05804.05804.2 | 3.6882 | 0.2481 | 100.0% | 1354.8922 | 1355.5339 | 12 | 6.046 | 58.3% | 3 | R.ALGQNPTNAEVLK.V | 2 | |
Astrin_STLC_112116_01.12162.12162.3 | 3.9575 | 0.392 | 100.0% | 1888.4043 | 1889.2628 | 1 | 6.776 | 46.7% | 3 | K.VLDFEHFLPMLQTVAK.N | 3 | |
Astrin_STLC_112116_tube2_01.12664.12664.2 | 4.0536 | 0.306 | 100.0% | 1889.3722 | 1889.2628 | 1 | 6.438 | 56.7% | 2 | K.VLDFEHFLPMLQTVAK.N | 2 | |
Astrin_STLC_112116_01.05576.05576.2 | 2.1228 | 0.2127 | 95.3% | 996.1322 | 996.1949 | 134 | 6.122 | 50.0% | 2 | R.HVLVTLGEK.M | 2 |
U | gi|7657307|ref|NP_055 | 12 | 21 | 24.7% | 676 | 72190 | 6.7 | LIM domain-containing protein 1 [Homo sapiens] |
U | gi|576583519|ref|NP_0 | 4 | 4 | 24.2% | 335 | 36053 | 8.5 | glyceraldehyde-3-phosphate dehydrogenase isoform 1 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_01.14630.14630.3 | 4.2261 | 0.2374 | 99.5% | 3311.2144 | 3310.7634 | 1 | 4.275 | 24.1% | 1 | K.VDIVAINDPFIDLNYMVYMFQYDSTHGK.F | 3 |
Astrin_STLC_112116_tube2_01.12987.12987.3 | 4.9972 | 0.4317 | 100.0% | 2595.4143 | 2597.0044 | 1 | 7.559 | 34.8% | 1 | K.VIHDNFGIVEGLMTTVHAITATQK.T | 3 | |
Astrin_STLC_112116_tube2_01.07683.07683.2 | 3.1592 | 0.3571 | 100.0% | 1411.7522 | 1412.6292 | 52 | 6.113 | 46.4% | 1 | R.GALQNIIPASTGAAK.A | 2 | |
Astrin_STLC_112116_tube2_01.09912.09912.2 | 2.4271 | 0.2311 | 96.3% | 1764.0922 | 1764.8914 | 41 | 5.283 | 42.3% | 1 | K.LISWYDNEFGYSNR.V | 2 |
U | gi|13654278|ref|NP_11 | 2 | 2 | 23.9% | 109 | 12349 | 10.2 | SRA stem-loop-interacting RNA-binding protein, mitochondrial isoform 1 precursor [Homo sapiens] |
U | gi|392583865|ref|NP_0 | 2 | 2 | 24.3% | 107 | 12122 | 10.2 | SRA stem-loop-interacting RNA-binding protein, mitochondrial isoform 2 precursor [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_02.09381.09381.2 | 2.8297 | 0.3103 | 99.9% | 1566.5922 | 1565.7257 | 56 | 5.053 | 46.2% | 1 | R.GLGWVQFSSEEGLR.N | 2 | |
Astrin_STLC_112116_tube2_01.04165.04165.3 | 2.6514 | 0.3633 | 99.7% | 1423.1643 | 1423.5193 | 14 | 5.572 | 40.9% | 1 | K.LPQTSDDEKKDF.- | 3 |
U | gi|4826998|ref|NP_005 | 13 | 32 | 23.2% | 707 | 76150 | 9.4 | splicing factor, proline- and glutamine-rich [Homo sapiens] |
U | gi|4757834|ref|NP_004 | 3 | 4 | 23.2% | 211 | 23772 | 6.7 | BAG family molecular chaperone regulator 2 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.09834.09834.2 | 3.1991 | 0.2995 | 100.0% | 1329.1122 | 1329.5364 | 3 | 6.93 | 65.0% | 1 | R.LLESLDQLELR.V | 2 |
* | Astrin_STLC_112116_tube2_02.08245.08245.3 | 3.5019 | 0.2906 | 99.4% | 2400.5344 | 2400.6917 | 1 | 5.336 | 38.8% | 2 | R.TLTVEVSVETIRNPQQQESLK.H | 3 |
* | Astrin_STLC_112116_tube2_01.11814.11814.3 | 3.718 | 0.3578 | 99.8% | 1904.0944 | 1904.1705 | 1 | 6.578 | 40.6% | 1 | R.IIDEVVNKFLDDLGNAK.S | 3 |
U | gi|14141152|ref|NP_00 | 12 | 19 | 22.9% | 730 | 77516 | 8.7 | heterogeneous nuclear ribonucleoprotein M isoform a [Homo sapiens] |
U | gi|157412270|ref|NP_1 | 12 | 19 | 24.2% | 691 | 73621 | 8.8 | heterogeneous nuclear ribonucleoprotein M isoform b [Homo sapiens] |
U | gi|1005261228|ref|NP_ | 2 | 3 | 21.5% | 135 | 15516 | 9.8 | ubiquitin-60S ribosomal protein L40 isoform 2 [Homo sapiens] |
U | gi|601984520|ref|NP_0 | 2 | 3 | 4.2% | 685 | 77039 | 7.7 | polyubiquitin-C [Homo sapiens] |
U | gi|528524471|ref|NP_0 | 2 | 3 | 12.7% | 229 | 25762 | 7.4 | polyubiquitin-B precursor [Homo sapiens] |
U | gi|4507761|ref|NP_003 | 2 | 3 | 22.7% | 128 | 14728 | 9.8 | ubiquitin-60S ribosomal protein L40 isoform 1 precursor [Homo sapiens] |
U | gi|294459921|ref|NP_0 | 2 | 3 | 18.6% | 156 | 17965 | 9.6 | ubiquitin-40S ribosomal protein S27a precursor [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_01.07041.07041.2 | 4.0022 | 0.4799 | 100.0% | 1788.1921 | 1788.9897 | 1 | 8.466 | 70.0% | 2 | K.TITLEVEPSDTIENVK.A | 2 | |
Astrin_STLC_112116_tube2_01.03603.03603.2 | 3.2005 | 0.3226 | 100.0% | 1524.0122 | 1524.6738 | 1 | 6.826 | 58.3% | 1 | K.IQDKEGIPPDQQR.L | 2 |
U | gi|32698730|ref|NP_06 | 7 | 21 | 21.3% | 695 | 76121 | 8.7 | nuclear fragile X mental retardation-interacting protein 2 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_01.04832.04832.2 | 3.45 | 0.383 | 100.0% | 1337.9321 | 1338.3763 | 1 | 7.122 | 75.0% | 8 | K.TGYGELNGNAGER.E | 2 |
* | Astrin_STLC_112116_tube2_01.04873.04873.2 | 4.0454 | 0.3919 | 100.0% | 1404.2722 | 1404.4764 | 1 | 8.559 | 66.7% | 3 | K.NLSSDEATNPISR.V | 2 |
* | Astrin_STLC_112116_tube2_01.05805.05805.2 | 3.9026 | 0.4989 | 100.0% | 1515.3522 | 1515.7068 | 1 | 8.204 | 73.1% | 4 | R.VLNGNQQVVDTSLK.Q | 2 |
* | Astrin_STLC_112116_02.07720.07720.3 | 3.5311 | 0.3258 | 99.6% | 3557.5745 | 3558.8555 | 1 | 4.707 | 22.7% | 1 | K.SGENQSVDKSDTIPIPNGVVTNNSGYITNGYMGK.G | 3 |
* | Astrin_STLC_112116_01.05915.05915.2 | 3.4145 | 0.3147 | 100.0% | 1375.3722 | 1375.6233 | 5 | 5.166 | 68.2% | 3 | K.IMQQETSVPTLK.Q | 2 |
* | Astrin_STLC_112116_tube2_01.03686.03686.3 | 5.7114 | 0.0944 | 97.7% | 2973.0842 | 2973.903 | 3 | 5.638 | 39.3% | 1 | K.TIQNSSVSPT#SSSSSSSSTGETQTQSSSR.L | 3 |
* | Astrin_STLC_112116_tube2_01.11122.11122.3 | 4.2462 | 0.3851 | 99.8% | 3560.9343 | 3561.0437 | 4 | 5.593 | 20.3% | 1 | K.VMEVTFQGEYPATLVSQGAEIIPSGTEHPVFPK.A | 3 |
U | gi|14141166|ref|NP_11 | 5 | 6 | 21.0% | 362 | 38222 | 6.8 | poly(rC)-binding protein 2 isoform b [Homo sapiens] |
U | gi|193083114|ref|NP_0 | 5 | 6 | 23.9% | 318 | 33497 | 8.2 | poly(rC)-binding protein 2 isoform g [Homo sapiens] |
U | gi|193083112|ref|NP_0 | 5 | 6 | 22.7% | 335 | 35347 | 8.0 | poly(rC)-binding protein 2 isoform f [Homo sapiens] |
U | gi|193083110|ref|NP_0 | 5 | 6 | 21.1% | 361 | 38151 | 6.8 | poly(rC)-binding protein 2 isoform e [Homo sapiens] |
U | gi|193083108|ref|NP_0 | 5 | 6 | 20.8% | 365 | 38580 | 6.8 | poly(rC)-binding protein 2 isoform d [Homo sapiens] |
U | gi|148833484|ref|NP_0 | 5 | 6 | 23.0% | 331 | 34917 | 8.0 | poly(rC)-binding protein 2 isoform c [Homo sapiens] |
U | gi|14141168|ref|NP_00 | 5 | 6 | 20.8% | 366 | 38651 | 6.8 | poly(rC)-binding protein 2 isoform a [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_01.04785.04785.2 | 2.6149 | 0.3304 | 100.0% | 1288.6921 | 1289.3538 | 1 | 6.269 | 70.0% | 1 | R.INISEGNCPER.I | 22 | |
Astrin_STLC_112116_tube2_01.09897.09897.2 | 2.6707 | 0.4497 | 100.0% | 1358.4122 | 1359.6519 | 6 | 6.877 | 54.2% | 2 | R.IITLAGPTNAIFK.A | 2 | |
Astrin_STLC_112116_tube2_01.07200.07200.2 | 5.4171 | 0.5695 | 100.0% | 2089.9722 | 2091.2573 | 1 | 9.631 | 57.9% | 1 | R.ESTGAQVQVAGDMLPNSTER.A | 22 | |
Astrin_STLC_112116_01.04576.04576.2 | 2.4173 | 0.3959 | 100.0% | 1158.4521 | 1159.2413 | 1 | 6.628 | 65.0% | 1 | K.IANPVEGSTDR.Q | 2 | |
Astrin_STLC_112116_02.10206.10206.3 | 4.2965 | 0.419 | 100.0% | 2205.9543 | 2206.5474 | 3 | 7.842 | 32.5% | 1 | R.QVTITGSAASISLAQYLINVR.L | 3 |
U | contaminant_KERATIN07 | 11 | 30 | 20.5% | 473 | 50915 | 5.5 | no description |
U | gi|4501881|ref|NP_001 | 6 | 14 | 19.9% | 377 | 42051 | 5.4 | actin, alpha skeletal muscle [Homo sapiens] |
U | gi|4885049|ref|NP_005 | 6 | 14 | 19.9% | 377 | 42019 | 5.4 | actin, alpha cardiac muscle 1 precursor [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_01.04121.04121.2 | 3.4288 | 0.4105 | 100.0% | 976.9122 | 977.02136 | 1 | 7.125 | 88.9% | 1 | K.AGFAGDDAPR.A | 22 | |
Astrin_STLC_112116_01.06117.06117.2 | 2.8748 | 0.4046 | 100.0% | 1198.4922 | 1199.4415 | 1 | 6.426 | 75.0% | 2 | R.AVFPSIVGRPR.H | 22 | |
Astrin_STLC_112116_tube2_01.08398.08398.2 | 3.9523 | 0.2748 | 100.0% | 1961.9922 | 1962.1841 | 2 | 6.652 | 53.3% | 1 | K.YPIEHGIITNWDDMEK.I | 2 | |
Astrin_STLC_112116_01.05896.05896.3 | 3.0002 | 0.2301 | 98.6% | 1516.4343 | 1516.7019 | 5 | 5.183 | 45.0% | 2 | K.IWHHTFYNELR.V | 33 | |
Astrin_STLC_112116_tube2_01.09467.09467.2 | 4.7773 | 0.4402 | 100.0% | 1792.1322 | 1791.9554 | 1 | 8.114 | 80.0% | 7 | K.SYELPDGQVITIGNER.F | 222 | |
Astrin_STLC_112116_tube2_01.06340.06340.1 | 2.3171 | 0.4487 | 100.0% | 1161.5 | 1162.3868 | 22 | 7.087 | 55.0% | 1 | K.EITALAPSTMK.I | 11 |
U | gi|4505591|ref|NP_002 | 3 | 4 | 19.6% | 199 | 22110 | 8.1 | peroxiredoxin-1 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_02.08834.08834.3 | 2.7159 | 0.3404 | 99.5% | 1984.0443 | 1984.2163 | 1 | 5.156 | 41.2% | 1 | R.TIAQDYGVLKADEGISFR.G | 3 |
Astrin_STLC_112116_01.06268.06268.2 | 2.5742 | 0.3079 | 99.8% | 1211.4321 | 1212.3915 | 155 | 5.375 | 55.0% | 2 | R.QITVNDLPVGR.S | 2 | |
* | Astrin_STLC_112116_tube2_01.08045.08045.2 | 2.596 | 0.395 | 100.0% | 1196.8322 | 1197.3763 | 1 | 6.474 | 72.2% | 1 | R.LVQAFQFTDK.H | 2 |
U | gi|22748747|ref|NP_68 | 2 | 7 | 19.0% | 195 | 21701 | 7.8 | protein LSM12 homolog [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_02.06703.06703.2 | 4.2584 | 0.4837 | 100.0% | 1483.9722 | 1484.6488 | 1 | 9.269 | 75.0% | 3 | R.LQGEVVAFDYQSK.M | 2 |
* | Astrin_STLC_112116_02.08539.08539.3 | 4.3583 | 0.4094 | 100.0% | 2589.9844 | 2590.939 | 1 | 7.511 | 33.7% | 4 | K.LSQAYAISAGVSLEGQQLFQTIHK.T | 3 |
U | gi|21464101|ref|NP_03 | 2 | 2 | 18.2% | 247 | 28303 | 4.9 | 14-3-3 protein gamma [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.09189.09189.2 | 3.1391 | 0.1066 | 95.7% | 1799.1122 | 1798.8473 | 48 | 3.321 | 46.7% | 1 | R.VISS*IEQK@TSADGNEK.K | 2 |
* | Astrin_STLC_112116_tube2_01.15540.15540.3 | 5.4392 | 0.5124 | 100.0% | 3303.4744 | 3303.6626 | 1 | 9.121 | 29.5% | 1 | K.TAFDDAIAELDTLNEDSYKDSTLIMQLLR.D | 3 |
U | gi|21626466|ref|NP_06 | 10 | 12 | 17.0% | 847 | 94623 | 6.3 | matrin-3 isoform a [Homo sapiens] |
U | gi|117956403|ref|NP_0 | 8 | 15 | 16.9% | 569 | 63543 | 4.8 | rab GTPase-binding effector protein 2 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_01.04074.04074.2 | 4.8189 | 0.4987 | 100.0% | 1621.8522 | 1621.6146 | 1 | 8.071 | 66.7% | 1 | R.SQEGANGEAESGELSR.L | 2 |
* | Astrin_STLC_112116_tube2_01.06825.06825.3 | 3.581 | 0.3941 | 99.8% | 1715.3043 | 1715.9498 | 1 | 6.416 | 40.0% | 2 | R.HAPSLHGSTELLPLSR.D | 3 |
* | Astrin_STLC_112116_01.04616.04616.2 | 3.6294 | 0.3859 | 100.0% | 1317.9722 | 1318.4294 | 1 | 6.618 | 77.3% | 4 | R.TLQGTVSQAQER.V | 2 |
* | Astrin_STLC_112116_01.05060.05060.2 | 2.553 | 0.2882 | 99.7% | 1147.1921 | 1147.2273 | 43 | 5.331 | 66.7% | 1 | R.EALEEETVAR.A | 2 |
* | Astrin_STLC_112116_02.04330.04330.2 | 4.5728 | 0.3164 | 100.0% | 1531.0922 | 1531.6628 | 1 | 8.424 | 79.2% | 3 | R.LQAELETSEQVQR.D | 2 |
* | Astrin_STLC_112116_01.04898.04898.2 | 2.3781 | 0.2794 | 99.6% | 915.59216 | 915.08057 | 2 | 5.173 | 78.6% | 2 | R.LSQALQVR.L | 2 |
* | Astrin_STLC_112116_01.04494.04494.2 | 2.2295 | 0.2546 | 98.2% | 1073.9321 | 1074.179 | 1 | 4.977 | 81.2% | 1 | R.QAETLEQVR.S | 2 |
* | Astrin_STLC_112116_tube2_01.08200.08200.2 | 2.1169 | 0.2812 | 96.5% | 1346.2722 | 1347.5261 | 14 | 4.927 | 54.5% | 1 | R.SIMDEAPLTDVR.D | 2 |
U | gi|117190174|ref|NP_0 | 4 | 10 | 16.7% | 293 | 32338 | 5.1 | heterogeneous nuclear ribonucleoproteins C1/C2 isoform b [Homo sapiens] |
U | gi|117190192|ref|NP_0 | 4 | 10 | 16.0% | 306 | 33670 | 5.1 | heterogeneous nuclear ribonucleoproteins C1/C2 isoform a [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_02.08268.08268.2 | 2.9808 | 0.2844 | 100.0% | 1316.8322 | 1317.6145 | 1 | 5.377 | 63.6% | 4 | R.VFIGNLNTLVVK.K | 2 | |
Astrin_STLC_112116_tube2_01.06247.06247.2 | 2.7967 | 0.2648 | 99.9% | 1123.9122 | 1124.2792 | 1 | 4.963 | 66.7% | 1 | K.KSDVEAIFSK.Y | 2 | |
Astrin_STLC_112116_tube2_01.09366.09366.2 | 3.3442 | 0.5625 | 100.0% | 1329.6322 | 1330.4857 | 1 | 9.379 | 80.0% | 2 | K.GFAFVQYVNER.N | 2 | |
Astrin_STLC_112116_02.08272.08272.2 | 4.9223 | 0.4107 | 100.0% | 1683.9722 | 1684.0038 | 1 | 8.186 | 80.0% | 3 | R.MIAGQVLDINLAAEPK.V | 2 |
U | gi|27436946|ref|NP_73 | 9 | 14 | 16.3% | 664 | 74140 | 7.0 | lamin isoform A [Homo sapiens] |
U | gi|544063468|ref|NP_0 | 9 | 14 | 17.6% | 614 | 69249 | 6.6 | lamin isoform A-delta50 [Homo sapiens] |
U | gi|5031875|ref|NP_005 | 9 | 14 | 18.9% | 572 | 65135 | 6.8 | lamin isoform C [Homo sapiens] |
U | contaminant_KERATIN22 | 8 | 21 | 16.3% | 645 | 65865 | 8.0 | no description |
U | gi|47132620|ref|NP_00 | 8 | 21 | 16.4% | 639 | 65433 | 8.0 | keratin, type II cytoskeletal 2 epidermal [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_02.08821.08821.2 | 4.0914 | 0.379 | 100.0% | 1840.0322 | 1840.0055 | 1 | 6.582 | 42.9% | 1 | K.SISISVAGGGGGFGAAGGFGGR.G | 2 | |
Astrin_STLC_112116_01.06138.06138.2 | 2.671 | 0.1258 | 96.8% | 1082.1522 | 1083.2755 | 1 | 5.557 | 81.2% | 1 | K.FASFIDKVR.F | 22222222 | |
Astrin_STLC_112116_tube2_01.06129.06129.2 | 4.5739 | 0.073 | 100.0% | 1475.7922 | 1476.6726 | 2 | 7.553 | 86.4% | 9 | R.FLEQQNQVLQTK.W | 222 | |
Astrin_STLC_112116_tube2_01.11175.11175.2 | 3.1902 | 0.4265 | 100.0% | 1461.1122 | 1461.6982 | 1 | 6.942 | 68.2% | 1 | K.VDLLNQEIEFLK.V | 2 | |
Astrin_STLC_112116_tube2_01.11450.11450.2 | 4.018 | 0.3758 | 100.0% | 1329.9722 | 1330.5211 | 1 | 7.458 | 86.4% | 3 | R.NLDLDSIIAEVK.A | 22222222 | |
Astrin_STLC_112116_tube2_01.06183.06183.2 | 2.735 | 0.1721 | 99.1% | 973.8722 | 974.102 | 1 | 4.527 | 85.7% | 2 | K.IEISELNR.V | 222 | |
Astrin_STLC_112116_tube2_01.10694.10694.3 | 3.2647 | 0.288 | 99.5% | 2198.3643 | 2199.4258 | 2 | 5.483 | 37.5% | 1 | R.NKLNDLEEALQQAKEDLAR.L | 3 | |
Astrin_STLC_112116_tube2_01.09346.09346.2 | 3.4818 | 0.346 | 100.0% | 1264.4122 | 1264.4644 | 1 | 7.748 | 80.0% | 3 | K.LALDVEIATYR.K | 222222222 |
U | gi|119395754|ref|NP_0 | 9 | 14 | 16.3% | 590 | 62378 | 7.8 | keratin, type II cytoskeletal 5 [Homo sapiens] |
U | gi|4502491|ref|NP_001 | 2 | 3 | 16.0% | 282 | 31362 | 4.8 | complement component 1 Q subcomponent-binding protein, mitochondrial precursor [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_02.08800.08800.2 | 3.5255 | 0.4435 | 100.0% | 1621.7722 | 1622.79 | 1 | 7.162 | 60.7% | 2 | K.MSGGWELELNGTEAK.L | 2 |
* | Astrin_STLC_112116_01.15045.15045.3 | 4.1454 | 0.2841 | 99.6% | 3440.5144 | 3441.77 | 1 | 5.983 | 23.3% | 1 | R.GVDNTFADELVELSTALEHQEYITFLEDLK.S | 3 |
U | gi|345197228|ref|NP_0 | 2 | 2 | 16.0% | 188 | 21935 | 10.2 | transformer-2 protein homolog beta isoform 2 [Homo sapiens] |
U | gi|4759098|ref|NP_004 | 2 | 2 | 10.4% | 288 | 33666 | 11.2 | transformer-2 protein homolog beta isoform 1 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.08873.08873.2 | 4.3464 | 0.4103 | 100.0% | 1812.0322 | 1811.989 | 1 | 8.716 | 63.3% | 1 | K.YGPIADVSIVYDQQSR.R | 2 | |
Astrin_STLC_112116_02.08694.08694.2 | 3.0936 | 0.3167 | 100.0% | 1621.9722 | 1622.774 | 1 | 6.194 | 57.7% | 1 | R.GFAFVYFENVDDAK.E | 2 |
U | gi|24234688|ref|NP_00 | 8 | 10 | 15.9% | 679 | 73681 | 6.2 | stress-70 protein, mitochondrial precursor [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_01.06359.06359.2 | 2.4017 | 0.2438 | 96.7% | 1451.8522 | 1451.576 | 1 | 5.28 | 61.5% | 1 | R.TTPSVVAFTADGER.L | 2 |
* | Astrin_STLC_112116_01.04500.04500.2 | 3.0303 | 0.2 | 99.2% | 1343.4922 | 1342.4105 | 49 | 5.151 | 54.2% | 1 | R.ASNGDAWVEAHGK.L | 2 |
* | Astrin_STLC_112116_01.10181.10181.2 | 2.6987 | 0.2438 | 98.8% | 1554.0322 | 1554.8878 | 1 | 5.098 | 69.2% | 2 | K.LYSPSQIGAFVLMK.M | 2 |
* | Astrin_STLC_112116_tube2_01.08739.08739.2 | 2.494 | 0.2247 | 96.2% | 1695.2322 | 1695.8723 | 1 | 5.303 | 53.6% | 1 | K.NAVITVPAYFNDSQR.Q | 2 |
* | Astrin_STLC_112116_tube2_01.08201.08201.2 | 3.5531 | 0.2783 | 100.0% | 1242.9722 | 1243.4056 | 1 | 6.28 | 77.3% | 1 | K.DAGQISGLNVLR.V | 2 |
* | Astrin_STLC_112116_01.09460.09460.2 | 2.9253 | 0.3252 | 100.0% | 1361.9122 | 1362.5687 | 1 | 7.17 | 63.6% | 1 | R.AQFEGIVTDLIR.R | 2 |
* | Astrin_STLC_112116_tube2_01.08102.08102.2 | 3.4569 | 0.2544 | 100.0% | 1292.1322 | 1291.4496 | 1 | 7.269 | 80.0% | 2 | K.VQQTVQDLFGR.A | 2 |
* | Astrin_STLC_112116_tube2_02.07888.07888.2 | 4.7192 | 0.5154 | 100.0% | 1809.1522 | 1809.9707 | 1 | 9.101 | 50.0% | 1 | K.SQVFSTAADGQTQVEIK.V | 2 |
U | gi|157388995|ref|NP_0 | 4 | 5 | 15.5% | 361 | 41072 | 6.1 | protein-L-isoaspartate O-methyltransferase domain-containing protein 2 isoform 1 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.07045.07045.2 | 2.5742 | 0.1147 | 95.5% | 1093.9922 | 1093.2249 | 6 | 5.035 | 75.0% | 1 | R.TELVEQAFR.A | 2 | |
Astrin_STLC_112116_tube2_01.10493.10493.3 | 3.6113 | 0.237 | 99.1% | 2396.5144 | 2397.6458 | 1 | 5.117 | 30.6% | 1 | R.ADYYLEEFKENAYKDLAWK.H | 3 | |
* | Astrin_STLC_112116_01.08535.08535.2 | 2.4057 | 0.3015 | 99.2% | 1285.2722 | 1285.5848 | 57 | 4.935 | 50.0% | 2 | K.VGGILVMPLEEK.L | 2 |
Astrin_STLC_112116_tube2_01.09682.09682.3 | 4.3729 | 0.3551 | 100.0% | 1941.2043 | 1942.2836 | 1 | 6.302 | 38.3% | 1 | R.RMETIVFLDKEVFASR.I | 3 |
U | contaminant_KERATIN19 | 5 | 6 | 15.2% | 468 | 51203 | 5.5 | no description |
U | gi|67782365|ref|NP_00 | 5 | 6 | 15.1% | 469 | 51386 | 5.5 | keratin, type II cytoskeletal 7 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.05073.05073.2 | 3.3562 | 0.4523 | 100.0% | 1105.1322 | 1105.2388 | 2 | 7.126 | 68.2% | 2 | R.SAYGGPVGAGIR.E | 2 | |
Astrin_STLC_112116_01.06138.06138.2 | 2.671 | 0.1258 | 96.8% | 1082.1522 | 1083.2755 | 1 | 5.557 | 81.2% | 1 | K.FASFIDKVR.F | 22222222 | |
Astrin_STLC_112116_tube2_01.11061.11061.2 | 3.3565 | 0.4236 | 100.0% | 1443.1721 | 1443.686 | 1 | 7.82 | 66.7% | 1 | R.LPDIFEAQIAGLR.G | 2 | |
Astrin_STLC_112116_02.10114.10114.3 | 4.001 | 0.1555 | 95.2% | 3170.2744 | 3172.2698 | 1 | 5.794 | 28.8% | 1 | R.T#LNET#ELTELQSQISDTSVVLSMDNSR.S | 3 | |
Astrin_STLC_112116_tube2_01.05594.05594.2 | 3.1639 | 0.2805 | 100.0% | 1197.0122 | 1197.2897 | 1 | 6.472 | 83.3% | 1 | R.AEAEAWYQTK.F | 22 |
U | gi|4506687|ref|NP_001 | 2 | 2 | 15.2% | 145 | 17040 | 10.4 | 40S ribosomal protein S15 isoform 2 [Homo sapiens] |
U | gi|815891093|ref|NP_0 | 2 | 2 | 14.5% | 152 | 17723 | 10.4 | 40S ribosomal protein S15 isoform 1 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_01.14703.14703.2 | 5.3901 | 0.5562 | 100.0% | 2588.892 | 2589.938 | 1 | 9.497 | 50.0% | 1 | R.GVDLDQLLDMSYEQLMQLYSAR.Q | 2 | |
Astrin_STLC_112116_01.14693.14693.3 | 3.2868 | 0.3327 | 99.6% | 2589.0544 | 2589.938 | 24 | 5.573 | 26.2% | 1 | R.GVDLDQLLDMSYEQLMQLYSAR.Q | 3 |
U | gi|190360566|ref|NP_4 | 4 | 8 | 14.8% | 357 | 40675 | 5.7 | protein-L-isoaspartate O-methyltransferase domain-containing protein 1 isoform 1 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.16254.16254.2 | 3.6795 | 0.4196 | 100.0% | 2014.0922 | 2015.0698 | 1 | 6.777 | 58.3% | 2 | -.MGGAVS*AGEDNDDLIDNLK.E | 2 |
* | Astrin_STLC_112116_tube2_01.15956.15956.2 | 3.1365 | 0.5759 | 100.0% | 2774.372 | 2775.9177 | 1 | 9.268 | 35.4% | 3 | -.MGGAVS*AGEDNDDLIDNLKEAQYIR.T | 2 |
Astrin_STLC_112116_tube2_01.13167.13167.2 | 4.8931 | 0.5768 | 100.0% | 2013.4722 | 2014.4492 | 1 | 10.526 | 67.6% | 1 | K.VGGILVMPIEDQLTQIMR.T | 2 | |
Astrin_STLC_112116_tube2_01.06891.06891.2 | 2.7392 | 0.1168 | 95.9% | 1209.9122 | 1210.3472 | 10 | 4.147 | 72.2% | 2 | R.NFINDEMQAK.G | 2 |
U | gi|198041662|ref|NP_0 | 3 | 3 | 14.3% | 286 | 29893 | 8.1 | pyrroline-5-carboxylate reductase 3 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.07614.07614.2 | 2.8052 | 0.3913 | 100.0% | 1100.1721 | 1101.3525 | 2 | 6.674 | 75.0% | 1 | R.MAGAIAQGLIR.A | 2 |
* | Astrin_STLC_112116_tube2_01.04608.04608.3 | 3.141 | 0.207 | 96.5% | 1764.5643 | 1764.9791 | 5 | 4.376 | 35.9% | 1 | R.AGKVEAQHILASAPTDR.N | 3 |
* | Astrin_STLC_112116_tube2_01.04384.04384.3 | 2.8977 | 0.2201 | 96.8% | 1531.4644 | 1530.7881 | 107 | 4.241 | 35.4% | 1 | K.MLLHEGQHPAQLR.S | 3 |
U | gi|221307584|ref|NP_0 | 3 | 3 | 14.0% | 299 | 33296 | 9.8 | prohibitin-2 isoform 1 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.08728.08728.2 | 2.6107 | 0.29 | 99.3% | 1260.6522 | 1260.5222 | 1 | 6.401 | 62.5% | 1 | K.LLLGAGAVAYGVR.E | 2 | |
Astrin_STLC_112116_tube2_02.09115.09115.3 | 2.5832 | 0.2729 | 96.9% | 1854.5343 | 1855.1038 | 1 | 4.771 | 37.5% | 1 | R.IGGVQQDTILAEGLHFR.I | 3 | |
* | Astrin_STLC_112116_01.03916.03916.2 | 3.8409 | 0.4618 | 100.0% | 1216.0122 | 1216.3336 | 1 | 8.733 | 81.8% | 1 | K.IVQAEGEAEAAK.M | 2 |
U | gi|4506619|ref|NP_000 | 2 | 3 | 14.0% | 157 | 17779 | 11.3 | 60S ribosomal protein L24 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.09795.09795.2 | 2.3784 | 0.2813 | 99.3% | 1193.3522 | 1193.391 | 4 | 4.721 | 68.8% | 1 | R.QINWTVLYR.R | 2 |
* | Astrin_STLC_112116_01.07278.07278.2 | 3.4967 | 0.4401 | 100.0% | 1262.0122 | 1262.5072 | 1 | 9.269 | 75.0% | 2 | R.AITGASLADIMAK.R | 2 |
U | gi|4502303|ref|NP_001 | 2 | 2 | 13.1% | 213 | 23277 | 10.0 | ATP synthase subunit O, mitochondrial precursor [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.07123.07123.2 | 2.788 | 0.4408 | 100.0% | 1161.2122 | 1161.3867 | 1 | 6.59 | 75.0% | 1 | K.VAASVLNPYVK.R | 2 |
* | Astrin_STLC_112116_tube2_01.12709.12709.2 | 3.382 | 0.4355 | 100.0% | 1873.5922 | 1874.1472 | 3 | 7.455 | 46.9% | 1 | R.FSPLTTNLINLLAENGR.L | 2 |
U | gi|4885399|ref|NP_005 | 11 | 13 | 12.9% | 1217 | 141541 | 7.2 | structural maintenance of chromosomes protein 3 [Homo sapiens] &IC SMC3 |
U | gi|124256496|ref|NP_0 | 7 | 19 | 12.8% | 641 | 70375 | 6.0 | heat shock 70 kDa protein 1-like [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.07222.07222.2 | 3.2644 | 0.4305 | 100.0% | 1488.9722 | 1488.5939 | 1 | 8.322 | 79.2% | 5 | R.TTPSYVAFTDTER.L | 2222 | |
Astrin_STLC_112116_01.09358.09358.2 | 3.1419 | 0.4076 | 100.0% | 1615.4122 | 1615.8817 | 1 | 6.598 | 73.1% | 3 | K.AFYPEEISSMVLTK.L | 22 | |
Astrin_STLC_112116_tube2_01.09728.09728.2 | 3.5325 | 0.3274 | 100.0% | 1198.2322 | 1198.408 | 1 | 6.836 | 86.4% | 6 | K.DAGVIAGLNVLR.I | 22 | |
Astrin_STLC_112116_tube2_01.09259.09259.2 | 3.9717 | 0.4271 | 100.0% | 1661.6322 | 1660.9078 | 1 | 7.009 | 73.3% | 2 | R.IINEPTAAAIAYGLDK.G | 222 | |
Astrin_STLC_112116_01.05559.05559.2 | 3.8525 | 0.3976 | 100.0% | 1675.8522 | 1676.6964 | 1 | 8.003 | 56.7% | 1 | K.ATAGDTHLGGEDFDNR.L | 222 | |
Astrin_STLC_112116_tube2_01.04581.04581.3 | 3.1587 | 0.2499 | 98.6% | 1676.1543 | 1676.6964 | 126 | 5.668 | 31.7% | 1 | K.ATAGDTHLGGEDFDNR.L | 333 | |
Astrin_STLC_112116_tube2_01.08427.08427.2 | 3.1583 | 0.3764 | 100.0% | 1288.0922 | 1288.4608 | 1 | 6.75 | 80.0% | 1 | K.NALESYAFNMK.S | 22 |
U | gi|24307939|ref|NP_03 | 4 | 6 | 12.8% | 541 | 59671 | 5.6 | T-complex protein 1 subunit epsilon isoform a [Homo sapiens] |
U | gi|807066366|ref|NP_0 | 4 | 6 | 13.7% | 503 | 55349 | 5.5 | T-complex protein 1 subunit epsilon isoform e [Homo sapiens] |
U | gi|807066360|ref|NP_0 | 4 | 6 | 13.3% | 520 | 57144 | 5.6 | T-complex protein 1 subunit epsilon isoform b [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_01.15586.15586.3 | 3.3306 | 0.2331 | 97.4% | 3116.0044 | 3115.3752 | 4 | 4.271 | 21.6% | 1 | K.SQDDEIGDGTTGVVVLAGALLEEAEQLLDR.G | 3 | |
Astrin_STLC_112116_01.04145.04145.2 | 2.5882 | 0.3716 | 100.0% | 1093.7922 | 1094.1692 | 1 | 6.164 | 77.8% | 1 | R.IADGYEQAAR.V | 2 | |
Astrin_STLC_112116_tube2_01.08564.08564.2 | 2.6565 | 0.2766 | 99.5% | 1391.6921 | 1392.592 | 1 | 5.162 | 68.2% | 1 | R.DVDFELIKVEGK.V | 2 | |
Astrin_STLC_112116_tube2_01.13162.13162.2 | 3.2017 | 0.3197 | 100.0% | 1740.2522 | 1740.0122 | 1 | 6.511 | 46.9% | 3 | R.WVGGPEIELIAIATGGR.I | 2 |
U | gi|21359873|ref|NP_00 | 4 | 10 | 12.4% | 603 | 68255 | 8.9 | serine/threonine-protein kinase PLK1 [Homo sapiens] &IC PLK1 |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.05579.05579.2 | 3.0923 | 0.3758 | 100.0% | 1570.1322 | 1570.832 | 1 | 7.282 | 63.9% | 1 | K.AGVPGVAAPGAPAAAPPAK.E | 2 |
* | Astrin_STLC_112116_tube2_01.06259.06259.2 | 2.2583 | 0.299 | 98.7% | 1291.2722 | 1291.5363 | 1 | 5.927 | 68.2% | 1 | K.HINPVAASLIQK.M | 2 |
* | Astrin_STLC_112116_01.11223.11223.3 | 4.3752 | 0.3923 | 100.0% | 3311.3943 | 3312.7217 | 1 | 6.753 | 28.6% | 1 | K.MLQTDPTARPTINELLNDEFFTSGYIPAR.L | 3 |
* | Astrin_STLC_112116_tube2_01.09510.09510.2 | 4.3528 | 0.4026 | 100.0% | 1812.8922 | 1813.0172 | 1 | 7.557 | 67.9% | 7 | R.LILYNDGDSLQYIER.D | 2 |
U | gi|6678271|ref|NP_031 | 3 | 3 | 12.3% | 414 | 44740 | 6.2 | TAR DNA-binding protein 43 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.11716.11716.3 | 4.3398 | 0.4667 | 100.0% | 2625.0244 | 2626.03 | 2 | 7.546 | 29.3% | 1 | R.LVEGILHAPDAGWGNLVYVVNYPK.D | 3 |
* | Astrin_STLC_112116_01.05464.05464.2 | 2.0996 | 0.3495 | 99.3% | 1144.2322 | 1145.2543 | 3 | 6.041 | 68.8% | 1 | R.FTEYETQVK.V | 2 |
* | Astrin_STLC_112116_tube2_01.06810.06810.2 | 4.7236 | 0.5177 | 100.0% | 1726.9922 | 1727.7928 | 1 | 8.302 | 79.4% | 1 | R.FGGNPGGFGNQGGFGNSR.G | 2 |
U | gi|290656936|ref|NP_0 | 3 | 3 | 12.1% | 265 | 31005 | 8.4 | thymidine kinase 2, mitochondrial isoform 1 precursor [Homo sapiens] |
U | gi|429836851|ref|NP_0 | 3 | 3 | 14.8% | 216 | 25486 | 6.7 | thymidine kinase 2 isoform 5 [Homo sapiens] |
U | gi|290657146|ref|NP_0 | 3 | 3 | 13.3% | 240 | 28374 | 9.2 | thymidine kinase 2, mitochondrial isoform 3 precursor [Homo sapiens] |
U | gi|290656975|ref|NP_0 | 3 | 3 | 13.7% | 234 | 27562 | 6.8 | thymidine kinase 2 isoform 2 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.06323.06323.3 | 2.5067 | 0.2687 | 96.9% | 1568.1843 | 1568.7502 | 15 | 5.906 | 28.8% | 1 | R.GHNPLGLMYHDASR.W | 3 | |
Astrin_STLC_112116_tube2_01.09554.09554.2 | 2.3635 | 0.3271 | 99.8% | 1216.8322 | 1217.4099 | 1 | 5.749 | 75.0% | 1 | R.YIFVENLYR.S | 2 | |
Astrin_STLC_112116_tube2_01.08868.08868.2 | 2.4927 | 0.3023 | 99.8% | 1179.8121 | 1180.3643 | 19 | 5.577 | 75.0% | 1 | R.MLELFEQNR.D | 2 |
U | contaminant_INT-STD1 | 7 | 11 | 12.0% | 607 | 69271 | 6.1 | BSA |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.08216.08216.2 | 2.7137 | 0.3802 | 100.0% | 1163.2722 | 1164.344 | 2 | 6.945 | 77.8% | 1 | K.LVNELTEFAK.T | 2 |
* | Astrin_STLC_112116_tube2_01.07150.07150.3 | 4.1847 | 0.3467 | 100.0% | 1440.6543 | 1440.6884 | 1 | 6.157 | 56.8% | 1 | R.RHPEYAVSVLLR.L | 3 |
* | Astrin_STLC_112116_tube2_01.06250.06250.2 | 2.6665 | 0.4137 | 100.0% | 1306.0521 | 1306.5046 | 1 | 7.644 | 70.0% | 1 | K.HLVDEPQNLIK.Q | 2 |
* | Astrin_STLC_112116_02.08136.08136.2 | 3.9229 | 0.3685 | 100.0% | 1480.0122 | 1480.7068 | 1 | 7.708 | 66.7% | 4 | K.LGEYGFQNALIVR.Y | 2 |
Astrin_STLC_112116_tube2_01.06873.06873.3 | 3.6048 | 0.3644 | 99.8% | 1640.2444 | 1640.9205 | 66 | 6.637 | 37.5% | 1 | R.KVPQVSTPTLVEVSR.S | 3 | |
Astrin_STLC_112116_tube2_01.06883.06883.2 | 2.852 | 0.2246 | 98.6% | 1641.0521 | 1640.9205 | 43 | 5.168 | 42.9% | 1 | R.KVPQVSTPTLVEVSR.S | 2 | |
* | Astrin_STLC_112116_tube2_01.11150.11150.2 | 3.6025 | 0.5011 | 100.0% | 1400.1721 | 1400.6324 | 1 | 9.953 | 72.7% | 2 | K.TVMENFVAFVDK.C | 2 |
U | gi|289577134|ref|NP_0 | 21 | 29 | 11.6% | 2243 | 262325 | 5.4 | golgin subfamily A member 4 isoform 1 [Homo sapiens] |
U | gi|6715600|ref|NP_002 | 21 | 29 | 11.7% | 2230 | 261137 | 5.4 | golgin subfamily A member 4 isoform 2 [Homo sapiens] |
U | gi|153792590|ref|NP_0 | 8 | 22 | 11.6% | 854 | 98161 | 5.2 | heat shock protein HSP 90-alpha isoform 1 [Homo sapiens] &IC Hsp90 |
U | gi|767980445|ref|XP_0 | 8 | 22 | 11.6% | 853 | 98074 | 5.2 | PREDICTED: heat shock protein HSP 90-alpha isoform X1 [Homo sapiens] &IC Hsp90 |
U | gi|154146191|ref|NP_0 | 8 | 22 | 13.5% | 732 | 84660 | 5.0 | heat shock protein HSP 90-alpha isoform 2 [Homo sapiens] &IC Hsp90 |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.08407.08407.2 | 3.4125 | 0.4213 | 100.0% | 1243.0322 | 1243.4459 | 1 | 6.622 | 72.7% | 2 | K.ADLINNLGTIAK.S | 22 | |
Astrin_STLC_112116_02.04492.04492.3 | 4.9004 | 0.4837 | 100.0% | 2015.3644 | 2016.2584 | 1 | 8.339 | 45.0% | 5 | K.VILHLKEDQTEYLEER.R | 33 | |
Astrin_STLC_112116_tube2_01.10168.10168.3 | 3.266 | 0.2517 | 98.7% | 2064.7144 | 2065.3794 | 4 | 5.243 | 34.4% | 1 | K.HSQFIGYPITLFVEKER.D | 3 | |
Astrin_STLC_112116_01.05163.05163.2 | 3.0953 | 0.2673 | 100.0% | 1151.8922 | 1152.2462 | 2 | 5.479 | 75.0% | 4 | K.YIDQEELNK.T | 22 | |
Astrin_STLC_112116_tube2_01.07911.07911.2 | 4.0786 | 0.414 | 100.0% | 1528.5721 | 1528.6616 | 1 | 7.285 | 75.0% | 2 | K.SLTNDWEDHLAVK.H | 22 | |
Astrin_STLC_112116_tube2_02.08226.08226.2 | 3.5056 | 0.4499 | 100.0% | 1348.9922 | 1349.4886 | 1 | 7.643 | 80.0% | 5 | K.HFSVEGQLEFR.A | 22 | |
Astrin_STLC_112116_01.05684.05684.2 | 2.5022 | 0.212 | 98.3% | 1224.9922 | 1225.3867 | 1 | 5.829 | 77.8% | 2 | K.HIYYITGETK.D | 2 | |
Astrin_STLC_112116_tube2_02.07900.07900.3 | 3.6627 | 0.3155 | 99.7% | 2442.8342 | 2442.6904 | 194 | 6.004 | 27.5% | 1 | K.HIYYITGETKDQVANSAFVER.L | 3 |
U | gi|162329583|ref|NP_0 | 5 | 6 | 11.6% | 551 | 59210 | 7.2 | cleavage and polyadenylation specificity factor subunit 6 isoform 1 [Homo sapiens] |
U | gi|665821177|ref|NP_0 | 5 | 6 | 10.9% | 588 | 63471 | 7.7 | cleavage and polyadenylation specificity factor subunit 6 isoform 2 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.07786.07786.2 | 3.6878 | 0.3941 | 100.0% | 1309.1921 | 1309.4619 | 1 | 6.066 | 76.9% | 1 | K.GFALVGVGSEASSK.K | 2 | |
Astrin_STLC_112116_tube2_01.08622.08622.2 | 3.1625 | 0.2621 | 100.0% | 1402.1322 | 1401.5798 | 2 | 5.036 | 70.0% | 1 | K.QFLSQFEMQSR.K | 2 | |
Astrin_STLC_112116_tube2_01.10008.10008.2 | 5.0384 | 0.5818 | 100.0% | 1665.8722 | 1666.8433 | 1 | 10.035 | 80.8% | 1 | R.TPLSEAEFEEIMNR.N | 2 | |
Astrin_STLC_112116_01.14870.14870.3 | 4.1663 | 0.4356 | 100.0% | 2453.2144 | 2453.749 | 1 | 7.59 | 39.6% | 1 | R.AVSDASAGDYGSAIETLVTAISLIK.Q | 3 | |
Astrin_STLC_112116_01.14876.14876.2 | 6.1134 | 0.5576 | 100.0% | 2453.8323 | 2453.749 | 1 | 11.511 | 58.3% | 2 | R.AVSDASAGDYGSAIETLVTAISLIK.Q | 2 |
U | gi|15809016|ref|NP_29 | 2 | 4 | 11.6% | 172 | 19779 | 4.8 | myosin regulatory light chain 12B [Homo sapiens] |
U | gi|740087210|ref|NP_0 | 2 | 4 | 11.3% | 177 | 20457 | 4.8 | myosin regulatory light chain 12A isoform 2 [Homo sapiens] |
U | gi|740087161|ref|NP_0 | 2 | 4 | 11.7% | 171 | 19794 | 4.8 | myosin regulatory light chain 12A isoform 1 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_02.09338.09338.3 | 3.5627 | 0.3819 | 99.8% | 2432.0645 | 2433.649 | 2 | 5.896 | 34.2% | 2 | R.ELLTTMGDRFTDEEVDELYR.E | 3 | |
Astrin_STLC_112116_tube2_01.07882.07882.2 | 3.3647 | 0.4492 | 100.0% | 1415.7722 | 1416.4839 | 1 | 8.394 | 90.0% | 2 | R.FTDEEVDELYR.E | 2 |
U | gi|15431297|ref|NP_00 | 2 | 2 | 11.4% | 211 | 24261 | 11.7 | 60S ribosomal protein L13 isoform 1 [Homo sapiens] |
U | gi|341604768|ref|NP_0 | 2 | 2 | 12.5% | 192 | 22184 | 11.6 | 60S ribosomal protein L13 isoform 2 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_01.04331.04331.2 | 2.4384 | 0.2629 | 98.9% | 1232.2522 | 1233.3237 | 4 | 5.529 | 65.0% | 1 | K.STESLQANVQR.L | 2 | |
Astrin_STLC_112116_tube2_01.07823.07823.2 | 2.7609 | 0.2165 | 98.6% | 1384.2522 | 1383.6923 | 1 | 4.773 | 66.7% | 1 | K.LATQLTGPVMPVR.N | 2 |
U | gi|5453994|ref|NP_006 | 4 | 5 | 11.1% | 631 | 71690 | 4.7 | double-strand-break repair protein rad21 homolog [Homo sapiens] &IC Rad21 |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.10319.10319.2 | 3.3043 | 0.325 | 100.0% | 2278.5122 | 2277.5767 | 2 | 6.383 | 40.0% | 1 | R.AQLSDYSDIVTTLDLAPPTKK.L | 2 |
* | Astrin_STLC_112116_tube2_01.10605.10605.2 | 2.9078 | 0.3999 | 100.0% | 1555.5922 | 1556.8075 | 1 | 6.996 | 66.7% | 2 | K.LFSLPAQPLWNNR.L | 2 |
* | Astrin_STLC_112116_tube2_01.07915.07915.2 | 3.2459 | 0.4251 | 100.0% | 1512.0322 | 1512.6567 | 1 | 7.624 | 62.5% | 1 | R.DVIDEPIIEEPSR.L | 2 |
* | Astrin_STLC_112116_01.03782.03782.3 | 5.5434 | 0.4273 | 100.0% | 2683.7043 | 2684.478 | 1 | 7.278 | 43.2% | 1 | K.EKEDDEEEEDEDASGGDQDQEER.R | 3 |
U | contaminant_KERATIN10 | 6 | 11 | 11.0% | 400 | 44106 | 5.1 | no description |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.05299.05299.2 | 3.2103 | 0.1537 | 99.8% | 1064.5721 | 1065.2578 | 1 | 6.052 | 81.2% | 2 | R.LASYLDKVR.A | 222222 | |
Astrin_STLC_112116_tube2_01.06544.06544.2 | 2.8305 | 0.168 | 99.0% | 1041.6322 | 1042.2235 | 1 | 5.465 | 93.8% | 2 | R.IVLQIDNAR.L | 22 | |
Astrin_STLC_112116_01.05584.05584.2 | 1.8322 | 0.255 | 95.2% | 807.8722 | 807.8815 | 186 | 5.3 | 66.7% | 1 | R.LAADDFR.T | 2222222 | |
Astrin_STLC_112116_tube2_01.07209.07209.2 | 3.3704 | 0.3259 | 100.0% | 1186.0521 | 1186.397 | 1 | 6.037 | 83.3% | 1 | R.RVLDELTLAR.T | 2222 | |
Astrin_STLC_112116_tube2_01.07839.07839.2 | 3.2486 | 0.3989 | 100.0% | 1030.0122 | 1030.2096 | 1 | 7.534 | 87.5% | 4 | R.VLDELTLAR.T | 22222 | |
Astrin_STLC_112116_tube2_01.04954.04954.2 | 2.7318 | 0.326 | 100.0% | 1122.9922 | 1123.2511 | 1 | 5.932 | 81.2% | 1 | R.LEQEIATYR.S | 22222 |
U | gi|50845386|ref|NP_00 | 4 | 5 | 10.9% | 339 | 38604 | 7.8 | annexin A2 isoform 2 [Homo sapiens] |
U | gi|50845388|ref|NP_00 | 4 | 5 | 10.4% | 357 | 40411 | 8.4 | annexin A2 isoform 1 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.12758.12758.2 | 2.4285 | 0.2709 | 97.9% | 1649.9922 | 1651.9872 | 1 | 5.509 | 50.0% | 1 | K.SALSGHLETVILGLLK.T | 2 | |
Astrin_STLC_112116_tube2_01.12712.12712.3 | 4.4865 | 0.1835 | 99.5% | 1651.9744 | 1651.9872 | 5 | 5.939 | 43.3% | 1 | K.SALSGHLETVILGLLK.T | 3 | |
Astrin_STLC_112116_tube2_01.04527.04527.2 | 3.2621 | 0.3162 | 100.0% | 1224.2722 | 1223.3251 | 1 | 6.046 | 75.0% | 2 | K.TPAQYDASELK.A | 2 | |
Astrin_STLC_112116_01.05152.05152.2 | 3.156 | 0.2851 | 100.0% | 1244.8722 | 1245.3347 | 6 | 5.874 | 72.2% | 1 | R.TNQELQEINR.V | 2 |
U | gi|4506399|ref|NP_003 | 2 | 3 | 10.6% | 368 | 40968 | 7.8 | mRNA export factor [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_02.07897.07897.3 | 4.1791 | 0.4259 | 100.0% | 2252.5444 | 2253.5376 | 2 | 6.506 | 32.9% | 2 | K.MWDLSSNQAIQIAQHDAPVK.T | 3 |
* | Astrin_STLC_112116_01.06948.06948.3 | 3.5449 | 0.1694 | 95.5% | 2187.5645 | 2187.5059 | 1 | 4.776 | 31.9% | 1 | R.VAIHYINPPNPAKDNFTFK.C | 3 |
U | gi|151301219|ref|NP_9 | 3 | 3 | 10.5% | 353 | 40548 | 5.5 | protein arginine N-methyltransferase 1 isoform 3 [Homo sapiens] |
U | gi|154759421|ref|NP_0 | 3 | 3 | 10.0% | 371 | 42462 | 5.3 | protein arginine N-methyltransferase 1 isoform 1 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_01.05832.05832.3 | 2.6643 | 0.2342 | 96.9% | 1351.1044 | 1351.6322 | 44 | 4.348 | 43.2% | 1 | K.ANKLDHVVTIIK.G | 3 | |
Astrin_STLC_112116_tube2_01.10225.10225.2 | 3.3941 | 0.3301 | 100.0% | 1643.5721 | 1643.8827 | 1 | 6.084 | 65.4% | 1 | R.DKWLAPDGLIFPDR.A | 2 | |
Astrin_STLC_112116_02.06949.06949.2 | 2.2171 | 0.3224 | 99.0% | 1252.7522 | 1252.4099 | 2 | 5.927 | 60.0% | 1 | R.ATLYVTAIEDR.Q | 2 |
U | gi|4507513|ref|NP_000 | 2 | 2 | 10.0% | 211 | 24145 | 8.7 | metalloproteinase inhibitor 3 precursor [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.10145.10145.2 | 2.3509 | 0.3919 | 99.9% | 1324.8322 | 1325.5474 | 1 | 6.147 | 54.5% | 1 | K.EGPFGTLVYTIK.Q | 2 |
* | Astrin_STLC_112116_tube2_01.07125.07125.2 | 2.9934 | 0.2848 | 100.0% | 1147.2322 | 1147.2761 | 1 | 5.144 | 93.8% | 1 | R.WDQLTLSQR.K | 2 |
U | gi|153791158|ref|NP_0 | 5 | 11 | 9.8% | 551 | 59560 | 7.7 | keratin, type II cytoskeletal 75 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.11450.11450.2 | 4.018 | 0.3758 | 100.0% | 1329.9722 | 1330.5211 | 1 | 7.458 | 86.4% | 3 | R.NLDLDSIIAEVK.A | 22222222 | |
Astrin_STLC_112116_01.04611.04611.2 | 2.7736 | 0.209 | 99.5% | 1081.0721 | 1080.1423 | 1 | 5.464 | 81.2% | 3 | K.AQYEDIANR.S | 22 | |
Astrin_STLC_112116_tube2_01.04497.04497.2 | 3.6681 | 0.3308 | 100.0% | 1456.0721 | 1456.5547 | 1 | 6.189 | 68.2% | 1 | R.SRAEAESWYQTK.Y | 22222 | |
Astrin_STLC_112116_tube2_01.05288.05288.2 | 3.4785 | 0.2191 | 100.0% | 1165.9722 | 1166.2761 | 1 | 6.834 | 88.9% | 1 | K.YEELQVTAGR.H | 2222 | |
Astrin_STLC_112116_tube2_01.09346.09346.2 | 3.4818 | 0.346 | 100.0% | 1264.4122 | 1264.4644 | 1 | 7.748 | 80.0% | 3 | K.LALDVEIATYR.K | 222222222 |
U | gi|109148552|ref|NP_4 | 4 | 6 | 9.4% | 628 | 64417 | 6.5 | keratin, type II cytoskeletal 3 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_01.06138.06138.2 | 2.671 | 0.1258 | 96.8% | 1082.1522 | 1083.2755 | 1 | 5.557 | 81.2% | 1 | K.FASFIDKVR.F | 22222222 | |
Astrin_STLC_112116_tube2_01.05492.05492.2 | 3.3041 | 0.3582 | 100.0% | 1351.4321 | 1351.5425 | 1 | 6.676 | 77.3% | 1 | R.TAAENEFVTLKK.D | 22222 | |
Astrin_STLC_112116_tube2_02.08776.08776.3 | 3.8367 | 0.2205 | 98.3% | 3055.1943 | 3056.3462 | 70 | 5.955 | 20.2% | 1 | R.TLYDAELSQMQSHISDTSVVLSMDNNR.S | 3 | |
Astrin_STLC_112116_tube2_01.09346.09346.2 | 3.4818 | 0.346 | 100.0% | 1264.4122 | 1264.4644 | 1 | 7.748 | 80.0% | 3 | K.LALDVEIATYR.K | 222222222 |
U | gi|194239729|ref|NP_0 | 2 | 3 | 9.3% | 257 | 28558 | 4.9 | elongation factor 1-delta isoform 4 [Homo sapiens] |
U | gi|304555583|ref|NP_0 | 2 | 3 | 3.7% | 647 | 71422 | 6.4 | elongation factor 1-delta isoform 1 [Homo sapiens] |
U | gi|194239731|ref|NP_0 | 2 | 3 | 8.5% | 281 | 31122 | 5.0 | elongation factor 1-delta isoform 2 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.06605.06605.2 | 3.5718 | 0.4487 | 100.0% | 1358.8322 | 1359.5223 | 1 | 7.534 | 81.8% | 2 | R.IASLEVENQSLR.G | 2 | |
Astrin_STLC_112116_tube2_01.09972.09972.2 | 3.3291 | 0.2751 | 100.0% | 1301.1721 | 1300.4978 | 1 | 5.314 | 81.8% | 1 | R.GVVQELQQAISK.L | 2 |
U | gi|157266292|ref|NP_0 | 3 | 3 | 9.1% | 528 | 56812 | 5.9 | intestinal-type alkaline phosphatase precursor [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_01.12041.12041.2 | 3.3045 | 0.5426 | 100.0% | 1957.4521 | 1958.3085 | 1 | 9.223 | 61.1% | 1 | K.NLILFLGDGLGVPTVTATR.I | 2 |
Astrin_STLC_112116_01.03993.03993.3 | 2.8831 | 0.408 | 99.8% | 1710.0844 | 1709.8618 | 289 | 5.781 | 28.3% | 1 | R.VQHASPAGTYAHTVNR.N | 3 | |
* | Astrin_STLC_112116_tube2_01.07339.07339.2 | 2.1794 | 0.2444 | 95.3% | 1485.6522 | 1484.5829 | 2 | 5.158 | 50.0% | 1 | R.NWYSDADMPASAR.Q | 2 |
U | gi|34419635|ref|NP_00 | 7 | 19 | 9.0% | 643 | 71028 | 6.1 | heat shock 70 kDa protein 6 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.07222.07222.2 | 3.2644 | 0.4305 | 100.0% | 1488.9722 | 1488.5939 | 1 | 8.322 | 79.2% | 5 | R.TTPSYVAFTDTER.L | 2222 | |
Astrin_STLC_112116_tube2_01.09474.09474.3 | 4.1847 | 0.3057 | 99.8% | 1688.9343 | 1688.9213 | 2 | 6.013 | 46.7% | 1 | R.IINEPTAAAIAYGLDR.R | 33 | |
Astrin_STLC_112116_tube2_01.09456.09456.2 | 5.2341 | 0.5236 | 100.0% | 1689.0322 | 1688.9213 | 1 | 9.8 | 80.0% | 6 | R.IINEPTAAAIAYGLDR.R | 22 | |
Astrin_STLC_112116_01.05559.05559.2 | 3.8525 | 0.3976 | 100.0% | 1675.8522 | 1676.6964 | 1 | 8.003 | 56.7% | 1 | K.ATAGDTHLGGEDFDNR.L | 222 | |
Astrin_STLC_112116_tube2_01.04581.04581.3 | 3.1587 | 0.2499 | 98.6% | 1676.1543 | 1676.6964 | 126 | 5.668 | 31.7% | 1 | K.ATAGDTHLGGEDFDNR.L | 333 | |
Astrin_STLC_112116_01.07436.07436.2 | 2.5451 | 0.3283 | 100.0% | 1081.7722 | 1082.2444 | 1 | 5.828 | 81.2% | 4 | K.LLQDFFNGK.E | 22 | |
Astrin_STLC_112116_01.07146.07146.2 | 3.6893 | 0.1587 | 99.8% | 1567.1122 | 1566.7972 | 1 | 4.243 | 75.0% | 1 | K.LLQDFFNGKELNK.S | 22 |
U | gi|63055057|ref|NP_00 | 2 | 8 | 9.0% | 376 | 42003 | 5.6 | beta-actin-like protein 2 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.07774.07774.3 | 3.5802 | 0.3173 | 99.7% | 1955.0343 | 1955.2615 | 10 | 5.664 | 33.8% | 1 | R.VAPDEHPILLTEAPLNPK.I | 3 |
Astrin_STLC_112116_tube2_01.09467.09467.2 | 4.7773 | 0.4402 | 100.0% | 1792.1322 | 1791.9554 | 1 | 8.114 | 80.0% | 7 | R.SYELPDGQVITIGNER.F | 222 |
U | gi|4506661|ref|NP_000 | 2 | 2 | 9.0% | 266 | 29996 | 10.6 | 60S ribosomal protein L7a [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.06942.06942.2 | 2.6034 | 0.2278 | 98.9% | 1217.6522 | 1217.3672 | 2 | 5.463 | 70.0% | 1 | K.NFGIGQDIQPK.R | 2 |
* | Astrin_STLC_112116_tube2_01.07171.07171.2 | 3.4442 | 0.0948 | 98.2% | 1346.8522 | 1346.5236 | 63 | 5.078 | 50.0% | 1 | R.AGVNTVTTLVENK.K | 2 |
U | gi|94721250|ref|NP_00 | 2 | 4 | 8.8% | 294 | 32614 | 8.9 | vesicle-associated membrane protein-associated protein A isoform 1 [Homo sapiens] |
U | gi|94721252|ref|NP_91 | 2 | 4 | 10.4% | 249 | 27893 | 8.6 | vesicle-associated membrane protein-associated protein A isoform 2 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.08329.08329.2 | 3.963 | 0.4148 | 100.0% | 1617.9122 | 1618.8705 | 1 | 7.315 | 69.2% | 2 | K.HEQILVLDPPTDLK.F | 2 | |
Astrin_STLC_112116_tube2_01.08240.08240.2 | 3.1828 | 0.289 | 100.0% | 1291.9922 | 1292.4747 | 17 | 6.544 | 54.5% | 2 | K.GPFTDVVTTNLK.L | 2 |
U | gi|195947382|ref|NP_8 | 2 | 3 | 8.7% | 403 | 47108 | 5.2 | RILP-like protein 1 isoform 1 [Homo sapiens] |
U | gi|984880766|ref|NP_0 | 2 | 3 | 9.1% | 386 | 44766 | 5.1 | RILP-like protein 1 isoform 2 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_01.15130.15130.3 | 2.9415 | 0.2754 | 97.7% | 3911.6042 | 3909.173 | 4 | 3.986 | 19.1% | 1 | R.GS*ALAAES*ALEK@NVAELTVMDVYDIASLVGHEFER.V | 3 | |
Astrin_STLC_112116_01.15130.15130.2 | 3.8769 | 0.4761 | 100.0% | 2608.0723 | 2608.9258 | 1 | 7.316 | 38.6% | 2 | K.NVAELTVMDVYDIASLVGHEFER.V | 3 |
U | gi|14141161|ref|NP_00 | 4 | 7 | 8.4% | 806 | 88980 | 5.8 | heterogeneous nuclear ribonucleoprotein U isoform b [Homo sapiens] |
U | gi|74136883|ref|NP_11 | 4 | 7 | 8.2% | 825 | 90585 | 6.0 | heterogeneous nuclear ribonucleoprotein U isoform a [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.09606.09606.2 | 2.3466 | 0.2613 | 96.7% | 1715.3722 | 1715.9469 | 19 | 5.214 | 38.2% | 1 | K.SSGPTSLFAVTVAPPGAR.Q | 2 | |
Astrin_STLC_112116_tube2_01.07871.07871.2 | 3.2726 | 0.4675 | 100.0% | 1698.0322 | 1698.8291 | 1 | 7.699 | 58.3% | 2 | R.GYFEYIEENKYSR.A | 2 | |
Astrin_STLC_112116_tube2_01.11181.11181.3 | 4.5807 | 0.4411 | 100.0% | 2724.3245 | 2726.0576 | 1 | 6.353 | 38.1% | 1 | K.EKPYFPIPEEYTFIQNVPLEDR.V | 3 | |
Astrin_STLC_112116_02.06988.06988.2 | 4.2999 | 0.4798 | 100.0% | 1648.3121 | 1648.816 | 1 | 8.18 | 75.0% | 3 | R.NFILDQTNVSAAAQR.R | 2 |
U | gi|4504811|ref|NP_002 | 4 | 4 | 8.2% | 745 | 81745 | 6.1 | junction plakoglobin [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_02.08599.08599.3 | 4.7921 | 0.4607 | 100.0% | 2030.3344 | 2030.245 | 1 | 7.737 | 41.2% | 1 | K.SAIVHLINYQDDAELATR.A | 3 |
* | Astrin_STLC_112116_tube2_01.06561.06561.2 | 3.4126 | 0.4129 | 100.0% | 1342.0122 | 1342.5321 | 1 | 8.19 | 77.3% | 1 | K.LLNDEDPVVVTK.A | 2 |
* | Astrin_STLC_112116_tube2_01.15636.15636.3 | 3.3937 | 0.3533 | 99.8% | 2348.7544 | 2348.7478 | 1 | 5.818 | 32.9% | 1 | R.LNTIPLFVQLLYSSVENIQR.V | 3 |
* | Astrin_STLC_112116_tube2_01.09221.09221.2 | 2.1973 | 0.3212 | 98.9% | 1236.1721 | 1237.4387 | 365 | 5.275 | 45.0% | 1 | R.VSVELTNSLFK.H | 2 |
U | gi|40254446|ref|NP_00 | 5 | 6 | 8.1% | 780 | 90955 | 8.0 | cullin-5 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.11922.11922.2 | 3.7458 | 0.4723 | 100.0% | 1812.4122 | 1812.0906 | 1 | 7.762 | 46.4% | 2 | K.LMLDTWNESIFSNIK.N | 2 |
* | Astrin_STLC_112116_02.08156.08156.2 | 4.0507 | 0.3852 | 100.0% | 1504.0721 | 1504.7263 | 1 | 8.045 | 57.7% | 1 | R.LGEAFDSQLVIGVR.E | 2 |
* | Astrin_STLC_112116_tube2_01.06538.06538.2 | 2.4587 | 0.2501 | 99.1% | 987.8722 | 988.13434 | 68 | 4.615 | 56.2% | 1 | K.ILNAGAWSR.S | 2 |
* | Astrin_STLC_112116_tube2_01.08160.08160.2 | 2.292 | 0.2429 | 97.8% | 1175.1921 | 1175.429 | 1 | 4.39 | 72.2% | 1 | R.TQEAIIQIMK.M | 2 |
* | Astrin_STLC_112116_01.11176.11176.2 | 3.0683 | 0.357 | 100.0% | 1699.3522 | 1699.9854 | 55 | 6.59 | 42.9% | 1 | K.ISNAQLQTELVEILK.N | 2 |
U | gi|1020738480|ref|NP_ | 2 | 3 | 8.0% | 498 | 56190 | 10.1 | RNA-binding protein 39 isoform e [Homo sapiens] |
U | gi|4757926|ref|NP_004 | 2 | 3 | 7.6% | 524 | 58657 | 10.1 | RNA-binding protein 39 isoform b [Homo sapiens] |
U | gi|35493811|ref|NP_90 | 2 | 3 | 7.5% | 530 | 59380 | 10.1 | RNA-binding protein 39 isoform a [Homo sapiens] |
U | gi|336176066|ref|NP_0 | 2 | 3 | 8.0% | 502 | 56367 | 10.0 | RNA-binding protein 39 isoform d [Homo sapiens] |
U | gi|336176064|ref|NP_0 | 2 | 3 | 7.9% | 508 | 57090 | 10.0 | RNA-binding protein 39 isoform c [Homo sapiens] |
U | gi|1020738594|ref|NP_ | 2 | 3 | 7.6% | 529 | 59293 | 10.1 | RNA-binding protein 39 isoform g [Homo sapiens] |
U | gi|1020738482|ref|NP_ | 2 | 3 | 10.7% | 373 | 40541 | 6.3 | RNA-binding protein 39 isoform f [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_02.10027.10027.3 | 3.8906 | 0.3315 | 99.8% | 2608.9143 | 2608.0098 | 6 | 5.848 | 27.1% | 1 | R.SKGIAYVEFVDVSSVPLAIGLTGQR.V | 3 | |
Astrin_STLC_112116_tube2_01.09472.09472.2 | 2.4647 | 0.3048 | 98.9% | 1551.9321 | 1552.8546 | 2 | 4.739 | 53.6% | 2 | R.VLGVPIIVQASQAEK.N | 2 |
U | gi|4503471|ref|NP_001 | 4 | 11 | 8.0% | 462 | 50141 | 9.0 | elongation factor 1-alpha 1 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_02.07851.07851.2 | 2.929 | 0.498 | 100.0% | 1589.3922 | 1589.835 | 1 | 7.613 | 64.3% | 1 | K.THINIVVIGHVDSGK.S | 2 | |
Astrin_STLC_112116_02.04456.04456.3 | 4.6557 | 0.4769 | 100.0% | 1589.8744 | 1589.835 | 1 | 8.198 | 55.4% | 6 | K.THINIVVIGHVDSGK.S | 3 | |
* | Astrin_STLC_112116_01.04186.04186.2 | 2.5589 | 0.2576 | 99.2% | 1283.1322 | 1283.3955 | 24 | 4.449 | 50.0% | 1 | K.MDSTEPPYSQK.R | 2 |
Astrin_STLC_112116_tube2_01.06157.06157.2 | 3.234 | 0.348 | 100.0% | 1025.9521 | 1026.2241 | 3 | 6.616 | 75.0% | 3 | K.IGGIGTVPVGR.V | 2 |
U | gi|41322908|ref|NP_95 | 26 | 30 | 7.9% | 4525 | 513712 | 5.8 | plectin isoform 1e [Homo sapiens] |
U | gi|47607492|ref|NP_00 | 26 | 30 | 7.8% | 4574 | 518478 | 5.7 | plectin isoform 1c [Homo sapiens] |
U | gi|41322923|ref|NP_95 | 26 | 30 | 7.9% | 4547 | 516204 | 5.8 | plectin isoform 1a [Homo sapiens] |
U | gi|41322919|ref|NP_95 | 26 | 30 | 7.9% | 4547 | 516282 | 5.8 | plectin isoform 1b [Homo sapiens] |
U | gi|41322916|ref|NP_95 | 26 | 30 | 7.6% | 4684 | 531796 | 6.0 | plectin isoform 1 [Homo sapiens] |
U | gi|41322914|ref|NP_95 | 26 | 30 | 7.9% | 4551 | 516484 | 5.8 | plectin isoform 1g [Homo sapiens] |
U | gi|41322912|ref|NP_95 | 26 | 30 | 7.9% | 4533 | 514780 | 5.7 | plectin isoform 1f [Homo sapiens] |
U | gi|41322910|ref|NP_95 | 26 | 30 | 7.9% | 4515 | 512609 | 5.8 | plectin isoform 1d [Homo sapiens] |
U | gi|30581135|ref|NP_00 | 8 | 11 | 7.8% | 1233 | 143233 | 7.6 | structural maintenance of chromosomes protein 1A isoform 1 [Homo sapiens] &IC SMC1A |
U | gi|527317371|ref|NP_0 | 8 | 11 | 7.9% | 1211 | 140859 | 7.4 | structural maintenance of chromosomes protein 1A isoform 2 [Homo sapiens] &IC SMC1A |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_01.12837.12837.2 | 4.0018 | 0.4071 | 100.0% | 1523.7722 | 1524.7723 | 1 | 7.51 | 65.4% | 2 | K.SNLMDAISFVLGEK.T | 2 | |
Astrin_STLC_112116_02.09918.09918.2 | 3.3837 | 0.4107 | 100.0% | 1653.3722 | 1654.9647 | 1 | 7.813 | 57.1% | 1 | R.NFLVFQGAVESIAMK.N | 2 | |
Astrin_STLC_112116_tube2_01.06822.06822.3 | 3.5234 | 0.2281 | 99.5% | 1454.0944 | 1454.6604 | 1 | 5.142 | 50.0% | 1 | R.IEKLEEYITTSK.Q | 3 | |
Astrin_STLC_112116_01.05420.05420.2 | 2.2875 | 0.2918 | 98.7% | 1091.2322 | 1091.2065 | 1 | 4.893 | 72.7% | 1 | K.SGVISGGASDLK.A | 2 | |
Astrin_STLC_112116_01.04109.04109.2 | 2.3378 | 0.3722 | 99.8% | 1383.3722 | 1383.5681 | 2 | 6.037 | 68.2% | 1 | R.QVQSQAHGLQMR.L | 2 | |
Astrin_STLC_112116_tube2_01.04270.04270.3 | 3.0542 | 0.3201 | 99.7% | 1439.8143 | 1440.5933 | 1 | 5.778 | 47.7% | 1 | R.LKYSQSDLEQTK.T | 3 | |
Astrin_STLC_112116_tube2_01.04880.04880.2 | 2.4637 | 0.2974 | 99.8% | 1065.8322 | 1066.2455 | 2 | 6.936 | 68.8% | 1 | R.HLALNLQEK.S | 2 | |
Astrin_STLC_112116_01.05116.05116.2 | 3.1528 | 0.2518 | 100.0% | 1216.1322 | 1215.3518 | 1 | 5.09 | 88.9% | 3 | K.LNEQQSVLQR.I | 2 |
U | gi|164419758|ref|NP_0 | 2 | 2 | 7.6% | 801 | 88061 | 9.1 | bromodomain-containing protein 2 isoform 1 [Homo sapiens] |
U | gi|634743319|ref|NP_0 | 2 | 2 | 9.0% | 681 | 74881 | 8.7 | bromodomain-containing protein 2 isoform 4 [Homo sapiens] |
U | gi|313747419|ref|NP_0 | 2 | 2 | 8.1% | 754 | 83151 | 9.1 | bromodomain-containing protein 2 isoform 3 [Homo sapiens] |
U | gi|313747417|ref|NP_0 | 2 | 2 | 7.3% | 836 | 92033 | 9.1 | bromodomain-containing protein 2 isoform 2 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.14634.14634.3 | 3.2912 | 0.2423 | 97.7% | 3327.2944 | 3328.5957 | 92 | 4.713 | 18.5% | 1 | K.GVK@RKADT#T#TPTPTAILAPGSPASPPGSLEPK@.A | 3 | |
Astrin_STLC_112116_tube2_02.16940.16940.3 | 2.801 | 0.2681 | 96.7% | 2599.1042 | 2596.697 | 4 | 4.206 | 24.1% | 1 | K.K@SKK@ASGSGGGSAALGPS*GFGPSGGSGTK@.L | 3 |
U | gi|29171705|ref|NP_80 | 2 | 2 | 7.6% | 606 | 64954 | 9.3 | melanoma-associated antigen D2 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.06922.06922.2 | 2.8845 | 0.2058 | 98.4% | 2478.7522 | 2476.6567 | 7 | 4.234 | 30.4% | 1 | R.EAPATQASSTTQLTDTQVLAAENK.S | 2 |
* | Astrin_STLC_112116_01.03632.03632.3 | 3.1293 | 0.3712 | 99.7% | 2191.0745 | 2192.1309 | 1 | 5.974 | 33.3% | 1 | K.HLDGEEDGSSDQSQASGTTGGR.R | 3 |
U | gi|381342476|ref|NP_0 | 2 | 3 | 7.6% | 449 | 49229 | 6.3 | heterogeneous nuclear ribonucleoprotein H [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_02.09416.09416.2 | 4.6949 | 0.4769 | 100.0% | 1842.0322 | 1843.0001 | 1 | 9.444 | 65.6% | 2 | R.STGEAFVQFASQEIAEK.A | 2 | |
Astrin_STLC_112116_tube2_01.11976.11976.2 | 4.062 | 0.4605 | 100.0% | 1998.2722 | 1998.2023 | 1 | 7.713 | 59.4% | 1 | R.ATENDIYNFFSPLNPVR.V | 2 |
U | gi|38201714|ref|NP_00 | 2 | 2 | 7.4% | 326 | 36092 | 9.2 | ELAV-like protein 1 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.09348.09348.2 | 2.4227 | 0.2825 | 98.8% | 1355.5922 | 1354.4998 | 1 | 4.371 | 62.5% | 1 | R.SLFSSIGEVESAK.L | 2 |
* | Astrin_STLC_112116_tube2_01.05222.05222.2 | 2.3559 | 0.3135 | 99.3% | 1188.5122 | 1189.3542 | 3 | 5.947 | 75.0% | 1 | R.VLVDQTTGLSR.G | 2 |
U | gi|14165435|ref|NP_11 | 2 | 2 | 7.1% | 463 | 50976 | 5.5 | heterogeneous nuclear ribonucleoprotein K isoform b [Homo sapiens] |
U | gi|970949444|ref|NP_0 | 2 | 2 | 7.5% | 440 | 48562 | 5.5 | heterogeneous nuclear ribonucleoprotein K isoform d [Homo sapiens] |
U | gi|970598247|ref|NP_0 | 2 | 2 | 7.5% | 439 | 48511 | 5.9 | heterogeneous nuclear ribonucleoprotein K isoform c [Homo sapiens] |
U | gi|14165439|ref|NP_00 | 2 | 2 | 7.1% | 464 | 51028 | 5.3 | heterogeneous nuclear ribonucleoprotein K isoform a [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.04322.04322.3 | 3.7733 | 0.3442 | 99.8% | 1735.8544 | 1736.8969 | 1 | 5.935 | 42.3% | 1 | K.RPAEDMEEEQAFKR.S | 3 | |
Astrin_STLC_112116_tube2_01.09482.09482.2 | 4.3224 | 0.5024 | 100.0% | 1917.2722 | 1918.1974 | 1 | 9.151 | 61.1% | 1 | R.GSYGDLGGPIITTQVTIPK.D | 2 |
U | gi|16753207|ref|NP_03 | 3 | 6 | 6.6% | 624 | 65696 | 5.2 | ubiquilin-2 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_01.03842.03842.2 | 3.7042 | 0.5133 | 100.0% | 1393.4122 | 1394.5272 | 1 | 9.35 | 70.0% | 1 | R.GPAAAQGSAAAPAEPK.I | 2 |
Astrin_STLC_112116_01.07331.07331.2 | 4.3527 | 0.3428 | 100.0% | 1812.8722 | 1813.1865 | 1 | 6.904 | 75.0% | 3 | R.QLIMANPQMQQLIQR.N | 2 | |
Astrin_STLC_112116_tube2_01.07459.07459.2 | 2.4541 | 0.4833 | 100.0% | 1238.0721 | 1239.5265 | 3 | 8.271 | 61.1% | 2 | R.NPAMMQEMMR.N | 2 |
U | Reverse_gi|21536349|r | 2 | 2 | 6.6% | 528 | 59910 | 5.7 | acid-sensing ion channel 1 isoform b [Homo sapiens] |
U | Reverse_gi|378744190| | 2 | 2 | 6.2% | 562 | 62700 | 5.1 | acid-sensing ion channel 1 isoform c [Homo sapiens] |
U | Reverse_gi|21536351|r | 2 | 2 | 6.1% | 574 | 64783 | 6.1 | acid-sensing ion channel 1 isoform a [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_02.11792.11792.2 | 2.0812 | 0.2785 | 95.2% | 1882.7122 | 1882.0269 | 2 | 5.223 | 37.5% | 1 | R.KVDDLS*LAVGK@DASSRK.A | 2 | |
Astrin_STLC_112116_01.12006.12006.2 | 3.7255 | 0.1503 | 99.4% | 2080.372 | 2081.402 | 1 | 4.11 | 47.1% | 1 | K.ALYK@ASAK@SPIK@VMS*LEK.G | 2 |
U | gi|115298682|ref|NP_0 | 11 | 17 | 6.5% | 2817 | 308606 | 9.1 | protein PRRC2C [Homo sapiens] |
U | gi|4758012|ref|NP_004 | 8 | 12 | 6.4% | 1675 | 191613 | 5.7 | clathrin heavy chain 1 isoform 1 [Homo sapiens] |
U | gi|568815719|ref|NP_0 | 8 | 12 | 6.4% | 1679 | 192057 | 5.7 | clathrin heavy chain 1 isoform 2 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.07853.07853.2 | 2.4226 | 0.2954 | 99.2% | 1337.9521 | 1338.5646 | 1 | 5.663 | 63.6% | 1 | R.VVGAMQLYSVDR.K | 2 | |
Astrin_STLC_112116_01.07161.07161.2 | 3.3941 | 0.4674 | 100.0% | 1304.0721 | 1305.4331 | 1 | 7.655 | 68.2% | 2 | R.NNLAGAEELFAR.K | 2 | |
Astrin_STLC_112116_01.09629.09629.2 | 1.9147 | 0.3058 | 95.3% | 1433.9321 | 1434.6757 | 13 | 4.964 | 45.8% | 1 | K.SVDPTLALSVYLR.A | 2 | |
Astrin_STLC_112116_tube2_01.07711.07711.3 | 2.7755 | 0.2864 | 99.4% | 1621.8243 | 1621.8333 | 18 | 5.071 | 39.6% | 1 | R.ALEHFTDLYDIKR.A | 3 | |
Astrin_STLC_112116_tube2_01.04287.04287.2 | 2.5983 | 0.2632 | 99.3% | 1334.4122 | 1335.416 | 3 | 6.759 | 70.0% | 2 | K.IYIDSNNNPER.F | 2 | |
Astrin_STLC_112116_01.13156.13156.2 | 3.6595 | 0.3709 | 100.0% | 1947.2522 | 1948.2819 | 1 | 6.597 | 56.2% | 2 | K.AFMTADLPNELIELLEK.I | 2 | |
Astrin_STLC_112116_tube2_01.07713.07713.2 | 2.5189 | 0.3572 | 100.0% | 1296.3522 | 1297.4563 | 1 | 7.573 | 70.0% | 2 | K.LLYNNVSNFGR.L | 2 | |
Astrin_STLC_112116_tube2_01.08184.08184.3 | 3.6143 | 0.3117 | 99.7% | 1972.4343 | 1972.2083 | 1 | 5.868 | 37.5% | 1 | R.LASTLVHLGEYQAAVDGAR.K | 3 |
U | gi|46367787|ref|NP_00 | 2 | 4 | 6.3% | 636 | 70671 | 9.5 | polyadenylate-binding protein 1 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.13450.13450.3 | 5.0966 | 0.4015 | 100.0% | 2741.6643 | 2742.175 | 1 | 7.354 | 37.0% | 2 | K.ITGMLLEIDNSELLHMLESPESLR.S | 3 | |
Astrin_STLC_112116_tube2_01.06430.06430.3 | 4.4118 | 0.4509 | 100.0% | 1694.4243 | 1694.9285 | 1 | 7.238 | 48.3% | 2 | R.SKVDEAVAVLQAHQAK.E | 3 |
U | gi|32567786|ref|NP_78 | 3 | 7 | 6.2% | 535 | 57836 | 7.2 | keratin, type II cytoskeletal 79 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.11450.11450.2 | 4.018 | 0.3758 | 100.0% | 1329.9722 | 1330.5211 | 1 | 7.458 | 86.4% | 3 | R.NLDLDSIIAEVK.A | 22222222 | |
Astrin_STLC_112116_tube2_01.05594.05594.2 | 3.1639 | 0.2805 | 100.0% | 1197.0122 | 1197.2897 | 1 | 6.472 | 83.3% | 1 | R.AEAEAWYQTK.Y | 22 | |
Astrin_STLC_112116_tube2_01.09346.09346.2 | 3.4818 | 0.346 | 100.0% | 1264.4122 | 1264.4644 | 1 | 7.748 | 80.0% | 3 | K.LALDVEIATYR.K | 222222222 |
U | gi|301171467|ref|NP_0 | 3 | 4 | 5.9% | 661 | 73156 | 7.2 | ATP-dependent RNA helicase DDX3X isoform 2 [Homo sapiens] |
U | gi|87196351|ref|NP_00 | 3 | 4 | 5.9% | 662 | 73244 | 7.2 | ATP-dependent RNA helicase DDX3X isoform 1 [Homo sapiens] |
U | gi|301171475|ref|NP_0 | 3 | 4 | 6.0% | 646 | 71355 | 6.6 | ATP-dependent RNA helicase DDX3X isoform 3 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_02.08493.08493.2 | 2.2027 | 0.3607 | 99.5% | 1321.5922 | 1321.4729 | 20 | 5.689 | 55.0% | 1 | R.ELAVQIYEEAR.K | 2 | |
Astrin_STLC_112116_tube2_01.09379.09379.2 | 3.221 | 0.4391 | 100.0% | 1337.3922 | 1337.5946 | 1 | 8.296 | 90.0% | 2 | R.MLDMGFEPQIR.R | 2 | |
Astrin_STLC_112116_tube2_01.10373.10373.3 | 3.9418 | 0.281 | 99.7% | 2083.6443 | 2084.2957 | 1 | 5.545 | 42.2% | 1 | K.HVINFDLPSDIEEYVHR.I | 3 |
U | gi|4503529|ref|NP_001 | 2 | 2 | 5.9% | 406 | 46154 | 5.5 | eukaryotic initiation factor 4A-I isoform 1 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_01.07460.07460.2 | 2.5025 | 0.2745 | 99.4% | 1115.6522 | 1115.3585 | 236 | 5.18 | 55.6% | 1 | R.VLITTDLLAR.G | 2 | |
* | Astrin_STLC_112116_01.05607.05607.3 | 3.7702 | 0.4216 | 100.0% | 1589.9644 | 1590.8352 | 1 | 7.034 | 46.2% | 1 | R.KGVAINMVTEEDKR.T | 3 |
U | gi|114155142|ref|NP_0 | 9 | 12 | 5.5% | 2363 | 267290 | 5.0 | nucleoprotein TPR [Homo sapiens] &IC TPR |
U | gi|767910362|ref|XP_0 | 9 | 12 | 5.4% | 2368 | 267872 | 5.0 | PREDICTED: nucleoprotein TPR isoform X1 [Homo sapiens] &IC TPR |
U | gi|50345982|ref|NP_00 | 2 | 2 | 5.4% | 503 | 54494 | 8.2 | ATP synthase subunit alpha, mitochondrial isoform c [Homo sapiens] |
U | gi|50345984|ref|NP_00 | 2 | 2 | 4.9% | 553 | 59751 | 9.1 | ATP synthase subunit alpha, mitochondrial isoform a precursor [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.10157.10157.2 | 3.2955 | 0.3221 | 100.0% | 1625.0721 | 1625.8625 | 1 | 6.186 | 60.0% | 1 | R.TGAIVDVPVGEELLGR.V | 2 | |
Astrin_STLC_112116_tube2_01.07619.07619.2 | 2.6717 | 0.3529 | 100.0% | 1288.9122 | 1288.4863 | 1 | 7.164 | 75.0% | 1 | K.HALIIYDDLSK.Q | 2 |
U | gi|21361399|ref|NP_05 | 2 | 2 | 5.1% | 589 | 65309 | 5.1 | serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.08330.08330.2 | 2.1714 | 0.2156 | 95.4% | 1110.2122 | 1110.2145 | 1 | 3.983 | 83.3% | 1 | R.LAGGDWFTSR.T | 2 |
* | Astrin_STLC_112116_tube2_01.09718.09718.3 | 2.6786 | 0.2899 | 97.8% | 2194.4944 | 2195.5615 | 160 | 4.538 | 27.6% | 1 | K.IGPILDNSTLQSEVKPILEK.L | 3 |
U | gi|48762932|ref|NP_00 | 2 | 2 | 4.9% | 548 | 59621 | 5.6 | T-complex protein 1 subunit theta isoform 1 [Homo sapiens] |
U | gi|544711070|ref|NP_0 | 2 | 2 | 5.4% | 497 | 54106 | 5.3 | T-complex protein 1 subunit theta isoform 3 [Homo sapiens] |
U | gi|544711041|ref|NP_0 | 2 | 2 | 5.1% | 529 | 57645 | 5.4 | T-complex protein 1 subunit theta isoform 2 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.09252.09252.2 | 2.2518 | 0.2366 | 95.7% | 1334.2722 | 1334.5583 | 4 | 4.336 | 54.5% | 1 | K.LFVTNDAATILR.E | 2 | |
Astrin_STLC_112116_tube2_01.05379.05379.2 | 4.2609 | 0.6114 | 100.0% | 1373.4521 | 1373.5492 | 1 | 11.09 | 75.0% | 1 | K.AIADTGANVVVTGGK.V | 2 |
U | gi|19923142|ref|NP_00 | 3 | 6 | 4.8% | 876 | 97170 | 4.8 | importin subunit beta-1 isoform 1 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.12495.12495.2 | 3.0492 | 0.3278 | 100.0% | 1659.2922 | 1659.9231 | 2 | 5.982 | 53.6% | 1 | R.AAVENLPTFLVELSR.V | 2 |
* | Astrin_STLC_112116_01.04164.04164.2 | 3.2859 | 0.488 | 100.0% | 1226.0122 | 1226.378 | 1 | 8.069 | 77.3% | 2 | R.VLANPGNSQVAR.V | 2 |
Astrin_STLC_112116_tube2_01.10779.10779.2 | 3.9453 | 0.398 | 100.0% | 1607.2122 | 1606.8595 | 1 | 7.282 | 75.0% | 3 | K.LAATNALLNSLEFTK.A | 2 |
U | gi|109240550|ref|NP_0 | 2 | 2 | 4.8% | 523 | 58744 | 6.7 | paraspeckle component 1 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.07217.07217.2 | 2.4311 | 0.3062 | 99.5% | 1312.3922 | 1311.4368 | 1 | 5.516 | 80.0% | 1 | R.YGEPSEVFINR.D | 2 |
* | Astrin_STLC_112116_tube2_01.08750.08750.2 | 2.5839 | 0.1871 | 95.7% | 1649.6921 | 1650.7875 | 48 | 4.209 | 46.2% | 1 | R.FAQPGTFEFEYASR.W | 2 |
U | gi|38569421|ref|NP_00 | 4 | 6 | 4.7% | 1101 | 120839 | 7.3 | ATP-citrate synthase isoform 1 [Homo sapiens] |
U | gi|740086852|ref|NP_0 | 4 | 6 | 4.5% | 1145 | 125151 | 8.2 | ATP-citrate synthase isoform 4 [Homo sapiens] |
U | gi|740086846|ref|NP_0 | 4 | 6 | 4.5% | 1155 | 126218 | 8.2 | ATP-citrate synthase isoform 3 [Homo sapiens] |
U | gi|38569423|ref|NP_94 | 4 | 6 | 4.8% | 1091 | 119772 | 7.3 | ATP-citrate synthase isoform 2 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_01.04157.04157.2 | 3.1199 | 0.3601 | 100.0% | 1248.2322 | 1247.3561 | 1 | 5.636 | 65.0% | 1 | R.RGGPNYQEGLR.V | 2 | |
Astrin_STLC_112116_tube2_01.09688.09688.2 | 3.4673 | 0.2527 | 100.0% | 1504.2522 | 1504.7417 | 1 | 6.899 | 60.7% | 3 | K.IGNTGGMLDNILASK.L | 2 | |
Astrin_STLC_112116_01.05730.05730.2 | 2.6768 | 0.279 | 99.5% | 1368.1322 | 1368.5785 | 1 | 4.657 | 59.1% | 1 | K.LYRPGSVAYVSR.S | 2 | |
Astrin_STLC_112116_tube2_01.08381.08381.2 | 3.008 | 0.3584 | 100.0% | 1492.2122 | 1492.647 | 4 | 5.962 | 57.7% | 1 | R.SGGMSNELNNIISR.T | 2 |
U | gi|586798161|ref|NP_0 | 3 | 4 | 4.7% | 962 | 107895 | 4.9 | general vesicular transport factor p115 isoform 2 [Homo sapiens] |
U | gi|586798211|ref|NP_0 | 3 | 4 | 4.6% | 973 | 109194 | 4.9 | general vesicular transport factor p115 isoform 1 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.04261.04261.3 | 3.2639 | 0.2998 | 99.5% | 2026.7943 | 2027.2164 | 1 | 4.923 | 39.5% | 1 | R.GVMGGQSAGPQHTEAETIQK.L | 3 | |
Astrin_STLC_112116_tube2_01.04273.04273.3 | 3.2745 | 0.2324 | 99.1% | 1597.9744 | 1598.7556 | 1 | 5.906 | 47.9% | 1 | K.TLEQHDNIVTHYK.N | 3 | |
Astrin_STLC_112116_01.05572.05572.2 | 3.3059 | 0.47 | 100.0% | 1333.8722 | 1334.4692 | 1 | 8.185 | 72.7% | 2 | K.SQLNSQSVEITK.L | 2 |
U | gi|4507677|ref|NP_003 | 4 | 4 | 4.6% | 803 | 92469 | 4.8 | endoplasmin precursor [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.06912.06912.2 | 2.3994 | 0.2223 | 98.5% | 1081.7122 | 1082.204 | 3 | 5.429 | 68.8% | 1 | K.FAFQAEVNR.M | 2 |
Astrin_STLC_112116_tube2_01.06413.06413.2 | 2.4029 | 0.2186 | 96.4% | 1277.1322 | 1276.3861 | 13 | 4.594 | 54.5% | 1 | R.ELISNASDALDK.I | 22 | |
Astrin_STLC_112116_tube2_01.07956.07956.2 | 3.3531 | 0.2598 | 100.0% | 1545.4321 | 1545.733 | 1 | 5.563 | 65.4% | 1 | R.ELISNASDALDKIR.L | 22 | |
* | Astrin_STLC_112116_tube2_01.07908.07908.2 | 3.5147 | 0.4972 | 100.0% | 1486.1122 | 1486.622 | 8 | 7.518 | 53.8% | 1 | K.GVVDSDDLPLNVSR.E | 2 |
U | gi|1002095850|ref|NP_ | 2 | 2 | 4.6% | 759 | 86101 | 7.5 | scaffold attachment factor B1 isoform 5 [Homo sapiens] |
U | gi|321267473|ref|NP_0 | 2 | 2 | 4.1% | 848 | 95181 | 6.5 | scaffold attachment factor B1 isoform 4 [Homo sapiens] |
U | gi|321267471|ref|NP_0 | 2 | 2 | 3.8% | 916 | 102768 | 5.5 | scaffold attachment factor B1 isoform 2 [Homo sapiens] |
U | gi|321267469|ref|NP_0 | 2 | 2 | 3.8% | 917 | 102855 | 5.5 | scaffold attachment factor B1 isoform 1 [Homo sapiens] |
U | gi|21264343|ref|NP_00 | 2 | 2 | 3.8% | 915 | 102642 | 5.5 | scaffold attachment factor B1 isoform 3 [Homo sapiens] |
U | gi|1002095852|ref|NP_ | 2 | 2 | 3.8% | 914 | 102555 | 5.5 | scaffold attachment factor B1 isoform 6 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_01.03845.03845.3 | 2.6355 | 0.3414 | 99.4% | 2647.8542 | 2648.5098 | 5 | 5.151 | 30.7% | 1 | K.ESSTSEGADQKMS*S*PEDDSDTKR.L | 3 | |
Astrin_STLC_112116_tube2_01.08939.08939.2 | 3.2507 | 0.4489 | 100.0% | 1355.5521 | 1355.4929 | 1 | 6.963 | 77.3% | 1 | R.NFWVSGLSSTTR.A | 2 |
U | gi|751557636|ref|NP_0 | 3 | 3 | 4.6% | 718 | 83067 | 5.9 | mitotic spindle assembly checkpoint protein MAD1 isoform a [Homo sapiens] &IC Mad1 |
U | gi|751557638|ref|NP_0 | 3 | 3 | 5.3% | 626 | 72287 | 6.8 | mitotic spindle assembly checkpoint protein MAD1 isoform b precursor [Homo sapiens] &IC Mad1 |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_01.04446.04446.2 | 3.6617 | 0.2498 | 100.0% | 1273.2922 | 1273.3885 | 1 | 6.301 | 80.0% | 1 | K.IQELQASQEAR.A | 2 | |
Astrin_STLC_112116_tube2_01.06738.06738.2 | 3.0775 | 0.3827 | 100.0% | 1315.3121 | 1315.5095 | 1 | 7.106 | 77.3% | 1 | K.LSLQEQDAAIVK.N | 2 | |
Astrin_STLC_112116_tube2_01.07379.07379.2 | 2.9834 | 0.2663 | 100.0% | 1134.1122 | 1134.336 | 1 | 6.02 | 77.8% | 1 | R.LDQTMGLSIR.T | 2 |
U | gi|119395758|ref|NP_0 | 3 | 4 | 4.5% | 1272 | 141347 | 5.4 | protein diaphanous homolog 1 isoform 1 [Homo sapiens] |
U | gi|929981605|ref|NP_0 | 3 | 4 | 4.6% | 1250 | 139413 | 5.3 | protein diaphanous homolog 1 isoform 3 [Homo sapiens] |
U | gi|119395760|ref|NP_0 | 3 | 4 | 4.5% | 1263 | 140289 | 5.4 | protein diaphanous homolog 1 isoform 2 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.15902.15902.3 | 3.877 | 0.3607 | 99.8% | 3043.4343 | 3043.493 | 1 | 5.981 | 28.7% | 2 | R.VSLNNNPVSWVQTFGAEGLASLLDILKR.L | 3 | |
Astrin_STLC_112116_02.10327.10327.2 | 3.4601 | 0.365 | 100.0% | 1617.5122 | 1617.9415 | 3 | 5.99 | 53.8% | 1 | K.TMLETEEGILLLVR.A | 2 | |
Astrin_STLC_112116_tube2_01.11645.11645.2 | 2.6677 | 0.3279 | 99.7% | 1911.5322 | 1913.2012 | 1 | 5.097 | 42.9% | 1 | K.KLSVEEFFMDLHNFR.N | 2 |
U | gi|116063573|ref|NP_0 | 8 | 9 | 4.4% | 2639 | 280016 | 6.0 | filamin-A isoform 1 [Homo sapiens] |
U | gi|160420317|ref|NP_0 | 8 | 9 | 4.3% | 2647 | 280737 | 6.1 | filamin-A isoform 2 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_01.07889.07889.2 | 2.2887 | 0.2349 | 96.7% | 1285.4521 | 1286.5167 | 3 | 4.852 | 75.0% | 1 | K.LPQLPITNFSR.D | 2 | |
Astrin_STLC_112116_tube2_01.05918.05918.3 | 3.7892 | 0.3671 | 99.8% | 1648.8544 | 1647.8687 | 1 | 6.327 | 40.0% | 1 | K.TGVAVNKPAEFTVDAK.H | 3 | |
Astrin_STLC_112116_tube2_01.05381.05381.2 | 2.9087 | 0.4938 | 100.0% | 1429.9321 | 1430.5632 | 1 | 8.232 | 63.3% | 1 | K.AFGPGLQGGSAGSPAR.F | 2 | |
Astrin_STLC_112116_tube2_01.05433.05433.2 | 2.966 | 0.3832 | 100.0% | 1225.7122 | 1226.2854 | 5 | 7.002 | 65.0% | 1 | R.EATTEFSVDAR.A | 2 | |
Astrin_STLC_112116_tube2_01.06871.06871.2 | 4.0499 | 0.541 | 100.0% | 1571.0122 | 1571.7275 | 1 | 10.053 | 55.9% | 1 | R.GAGTGGLGLAVEGPSEAK.M | 2 | |
Astrin_STLC_112116_tube2_01.06748.06748.2 | 2.3631 | 0.3207 | 99.2% | 1435.3522 | 1435.5767 | 1 | 6.033 | 58.3% | 1 | R.ANLPQSFQVDTSK.A | 2 | |
Astrin_STLC_112116_02.06922.06922.3 | 3.8928 | 0.3404 | 99.8% | 2201.0645 | 2201.4412 | 1 | 6.341 | 35.5% | 2 | R.LVSNHSLHETSSVFVDSLTK.A | 3 | |
Astrin_STLC_112116_01.05795.05795.2 | 2.3884 | 0.2441 | 98.5% | 1151.9722 | 1152.333 | 2 | 4.884 | 66.7% | 1 | K.DKGEYTLVVK.W | 2 |
U | gi|4506787|ref|NP_003 | 5 | 6 | 4.3% | 1657 | 189251 | 6.5 | ras GTPase-activating-like protein IQGAP1 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_01.04524.04524.2 | 2.573 | 0.1987 | 98.8% | 1093.4521 | 1094.1816 | 9 | 5.868 | 75.0% | 1 | R.LTAEEMDER.R | 2 |
* | Astrin_STLC_112116_01.15135.15135.3 | 5.9072 | 0.5382 | 100.0% | 2959.3743 | 2960.3574 | 1 | 8.866 | 33.9% | 1 | K.IGGILANELSVDEAALHAAVIAINEAIDR.R | 3 |
* | Astrin_STLC_112116_tube2_01.09991.09991.2 | 2.7637 | 0.3071 | 99.8% | 1543.7122 | 1543.763 | 6 | 6.949 | 62.5% | 1 | R.EQLWLANEGLITR.L | 2 |
* | Astrin_STLC_112116_tube2_01.05157.05157.2 | 2.4692 | 0.2134 | 98.0% | 1073.7122 | 1073.2316 | 2 | 5.386 | 72.2% | 1 | K.LTELGTVDPK.N | 2 |
* | Astrin_STLC_112116_tube2_01.04486.04486.2 | 3.1387 | 0.4591 | 100.0% | 1237.1122 | 1237.3983 | 1 | 7.697 | 75.0% | 2 | K.LQQTYAALNSK.A | 2 |
U | gi|154759259|ref|NP_0 | 6 | 8 | 3.8% | 2472 | 284538 | 5.3 | spectrin alpha chain, non-erythrocytic 1 isoform 2 [Homo sapiens] |
U | gi|306966132|ref|NP_0 | 6 | 8 | 3.8% | 2452 | 282280 | 5.3 | spectrin alpha chain, non-erythrocytic 1 isoform 3 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.04859.04859.2 | 2.9585 | 0.2861 | 100.0% | 1302.1322 | 1303.4117 | 4 | 5.781 | 70.0% | 1 | K.VLETAEDIQER.R | 2 | |
Astrin_STLC_112116_tube2_01.13522.13522.2 | 2.9373 | 0.3547 | 100.0% | 2128.2322 | 2128.344 | 1 | 7.079 | 35.0% | 1 | K.ALINADELASDVAGAEALLDR.H | 2 | |
Astrin_STLC_112116_tube2_01.10658.10658.3 | 3.0272 | 0.3221 | 99.4% | 2035.4944 | 2033.3348 | 5 | 5.795 | 34.4% | 1 | K.KGDILTLLNSTNKDWWK.V | 3 | |
Astrin_STLC_112116_tube2_01.06652.06652.2 | 3.2447 | 0.4539 | 100.0% | 1394.2922 | 1394.5272 | 1 | 7.596 | 63.6% | 1 | K.LGESQTLQQFSR.D | 2 | |
Astrin_STLC_112116_tube2_01.04404.04404.3 | 3.1959 | 0.3349 | 99.7% | 2026.2544 | 2026.1644 | 1 | 5.249 | 47.1% | 1 | K.LQTASDESYKDPTNIQSK.H | 3 | |
Astrin_STLC_112116_tube2_01.11005.11005.2 | 4.5899 | 0.4379 | 100.0% | 1631.1921 | 1631.915 | 1 | 8.481 | 73.1% | 3 | R.LAALADQWQFLVQK.S | 2 |
U | gi|112382250|ref|NP_0 | 5 | 5 | 3.6% | 2364 | 274608 | 5.6 | spectrin beta chain, non-erythrocytic 1 isoform 1 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_01.15191.15191.3 | 4.5431 | 0.3874 | 100.0% | 3001.3743 | 3002.3655 | 1 | 7.629 | 32.0% | 1 | R.LEEASLLHQFQADADDIDAWMLDILK.I | 3 | |
Astrin_STLC_112116_01.10152.10152.2 | 2.5655 | 0.1953 | 97.6% | 1383.2522 | 1382.4723 | 1 | 5.317 | 70.0% | 1 | R.DLDDFQSWLSR.T | 2 | |
Astrin_STLC_112116_01.14943.14943.2 | 3.0258 | 0.2556 | 99.5% | 1944.5922 | 1945.1364 | 1 | 5.063 | 46.9% | 1 | K.DGLNEAWADLLELIDTR.T | 2 | |
Astrin_STLC_112116_tube2_01.03908.03908.3 | 3.3061 | 0.288 | 99.4% | 1764.8644 | 1763.9481 | 1 | 4.695 | 40.0% | 1 | R.LQAAYAGDKADDIQKR.E | 3 | |
* | Astrin_STLC_112116_tube2_01.05759.05759.2 | 2.6018 | 0.2366 | 98.0% | 1368.0721 | 1368.576 | 6 | 5.089 | 57.7% | 1 | K.TALPAQSAATLPAR.T | 2 |
U | gi|33350932|ref|NP_00 | 9 | 12 | 3.5% | 4646 | 532412 | 6.4 | cytoplasmic dynein 1 heavy chain 1 [Homo sapiens] &IC dynein heavy chain |
U | gi|13376798|ref|NP_07 | 2 | 2 | 3.5% | 721 | 79136 | 6.7 | WD repeat and coiled-coil-containing protein C2orf44 isoform 1 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_01.07518.07518.2 | 2.3317 | 0.2245 | 96.6% | 1266.1921 | 1265.452 | 42 | 4.487 | 55.0% | 1 | K.SDQYAISLIVR.E | 2 | |
* | Astrin_STLC_112116_tube2_01.10299.10299.2 | 2.6597 | 0.1701 | 95.7% | 1499.4321 | 1499.5339 | 10 | 4.586 | 46.2% | 1 | R.DSFS*HSPGAVSSLK.V | 2 |
U | gi|194578921|ref|NP_0 | 3 | 3 | 3.2% | 1311 | 145135 | 5.2 | C-Jun-amino-terminal kinase-interacting protein 4 isoform 2 [Homo sapiens] |
U | gi|354681995|ref|NP_0 | 3 | 3 | 3.6% | 1177 | 128607 | 5.4 | C-Jun-amino-terminal kinase-interacting protein 4 isoform 4 [Homo sapiens] |
U | gi|27436920|ref|NP_00 | 3 | 3 | 3.2% | 1307 | 144681 | 5.2 | C-Jun-amino-terminal kinase-interacting protein 4 isoform 3 [Homo sapiens] |
U | gi|194578923|ref|NP_0 | 3 | 3 | 3.2% | 1321 | 146205 | 5.1 | C-Jun-amino-terminal kinase-interacting protein 4 isoform 1 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_01.04553.04553.2 | 2.4651 | 0.3719 | 100.0% | 1309.6721 | 1310.4526 | 1 | 7.445 | 60.0% | 1 | K.HIEVQVAQETR.N | 2 | |
Astrin_STLC_112116_tube2_02.09724.09724.2 | 2.3596 | 0.2908 | 98.1% | 1887.2322 | 1887.1376 | 21 | 4.98 | 40.0% | 1 | R.EVENLILENTQLLETK.N | 2 | |
Astrin_STLC_112116_tube2_01.04064.04064.2 | 3.4415 | 0.3344 | 100.0% | 1467.8121 | 1468.6066 | 195 | 5.901 | 39.3% | 1 | K.AGPSAQEPGSQTPLK.S | 2 |
U | gi|557440899|ref|NP_0 | 4 | 4 | 2.6% | 2101 | 236513 | 5.8 | nuclear mitotic apparatus protein 1 isoform 2 [Homo sapiens] &IC NuMA |
U | gi|71361682|ref|NP_00 | 4 | 4 | 2.6% | 2115 | 238257 | 5.8 | nuclear mitotic apparatus protein 1 isoform 1 [Homo sapiens] &IC NuMA |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_01.04330.04330.2 | 3.6971 | 0.2577 | 100.0% | 1604.9722 | 1605.7197 | 1 | 6.079 | 69.2% | 1 | R.AALMESQGQQQEER.G | 2 | |
Astrin_STLC_112116_01.04178.04178.2 | 3.9371 | 0.3999 | 100.0% | 1260.9922 | 1261.3774 | 1 | 7.938 | 72.7% | 1 | R.LLQAETASNSAR.A | 2 | |
Astrin_STLC_112116_01.03692.03692.3 | 2.7008 | 0.2411 | 95.8% | 1829.0044 | 1828.9797 | 3 | 4.503 | 35.9% | 1 | K.LKAVQAQGGESQQEAQR.L | 3 | |
Astrin_STLC_112116_01.05022.05022.2 | 1.8778 | 0.311 | 95.7% | 1193.0521 | 1194.3762 | 42 | 4.565 | 55.0% | 1 | R.LGHELQQAGLK.T | 2 |
U | gi|54607053|ref|NP_00 | 4 | 4 | 2.5% | 2671 | 292708 | 7.4 | eIF-2-alpha kinase activator GCN1 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.04934.04934.2 | 2.0734 | 0.2787 | 98.2% | 992.2522 | 992.1661 | 18 | 5.415 | 64.3% | 1 | R.HLDQIIPR.M | 2 |
* | Astrin_STLC_112116_01.15404.15404.2 | 2.7719 | 0.2847 | 99.4% | 2237.1921 | 2238.627 | 1 | 6.426 | 40.0% | 1 | R.LQELDGELEAALGLLDIILAK.N | 2 |
* | Astrin_STLC_112116_tube2_01.15782.15782.2 | 3.7276 | 0.3765 | 100.0% | 2314.9922 | 2315.7583 | 1 | 7.24 | 40.0% | 1 | K.NPSGLTQYIPVLVDSFLPLLK.S | 2 |
* | Astrin_STLC_112116_01.12922.12922.2 | 3.4635 | 0.4457 | 100.0% | 1826.3922 | 1827.1307 | 1 | 7.119 | 63.3% | 1 | K.LVLPSLLAALEEESWR.T | 2 |
U | gi|62241042|ref|NP_00 | 3 | 3 | 2.5% | 1512 | 170590 | 7.3 | bifunctional glutamate/proline--tRNA ligase [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_02.10184.10184.2 | 4.6942 | 0.3298 | 100.0% | 1945.5322 | 1945.1846 | 1 | 7.235 | 56.2% | 1 | R.WFGFLEAQQAFQSVGTK.W | 2 |
* | Astrin_STLC_112116_01.06096.06096.2 | 2.1915 | 0.2188 | 95.7% | 1115.9321 | 1116.303 | 151 | 4.374 | 50.0% | 1 | R.LNLNNTVLSK.R | 2 |
* | Astrin_STLC_112116_01.04228.04228.2 | 2.8086 | 0.3734 | 100.0% | 1204.6921 | 1205.3074 | 1 | 6.89 | 75.0% | 1 | K.LTVAENEAETK.L | 2 |
U | gi|31621305|ref|NP_57 | 2 | 2 | 2.3% | 1394 | 157904 | 6.1 | leucine-rich PPR motif-containing protein, mitochondrial precursor [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_02.11149.11149.2 | 2.1354 | 0.3035 | 96.6% | 1725.5322 | 1725.939 | 104 | 5.633 | 33.3% | 1 | R.SEAANGNLDFVLSFLK.S | 2 |
* | Astrin_STLC_112116_tube2_01.15008.15008.2 | 4.3934 | 0.5149 | 100.0% | 1954.5521 | 1955.2764 | 1 | 8.848 | 50.0% | 1 | R.SMNINLWSEITELLYK.D | 2 |
U | gi|153792294|ref|NP_1 | 2 | 5 | 2.3% | 1320 | 145257 | 6.8 | myopalladin isoform a [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_tube2_01.07829.07829.3 | 3.432 | 0.3818 | 99.8% | 1947.9243 | 1948.1399 | 1 | 5.902 | 35.9% | 1 | R.LAINYDPLEKADETQAR.K | 3 |
* | Astrin_STLC_112116_01.13574.13574.2 | 4.2978 | 0.4976 | 100.0% | 1470.2122 | 1470.6624 | 1 | 8.279 | 79.2% | 4 | K.AADFIEELSSLFK.S | 2 |
U | gi|54859722|ref|NP_05 | 2 | 2 | 2.0% | 1436 | 162121 | 5.5 | nuclear pore complex protein Nup160 isoform 1 [Homo sapiens] &IC Nup160 |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_01.14832.14832.2 | 3.9425 | 0.4802 | 100.0% | 2097.7122 | 2098.4062 | 1 | 9.172 | 44.1% | 1 | R.FVSSPQTIVELFFQEVAR.K | 2 |
* | Astrin_STLC_112116_01.04732.04732.2 | 2.5214 | 0.3074 | 99.7% | 1191.1522 | 1190.2523 | 12 | 5.342 | 60.0% | 1 | R.SEDGEIVSTPR.L | 2 |
U | gi|365192532|ref|NP_0 | 4 | 4 | 1.9% | 2007 | 232526 | 5.6 | myosin-10 isoform 1 [Homo sapiens] |
U | gi|367460090|ref|NP_0 | 4 | 4 | 1.9% | 1985 | 230028 | 5.6 | myosin-10 isoform 3 [Homo sapiens] |
U | gi|367460087|ref|NP_0 | 4 | 4 | 1.9% | 1976 | 228997 | 5.5 | myosin-10 isoform 2 [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_01.06986.06986.2 | 2.3058 | 0.2699 | 96.7% | 1649.6921 | 1649.8436 | 77 | 4.566 | 46.4% | 1 | R.AVIYNPATQADWTAK.K | 2 | |
Astrin_STLC_112116_tube2_01.06060.06060.2 | 2.9889 | 0.1978 | 99.6% | 1222.1122 | 1221.3959 | 13 | 4.489 | 66.7% | 1 | K.KFDQLLAEEK.S | 22 | |
Astrin_STLC_112116_tube2_01.06341.06341.2 | 2.6047 | 0.1138 | 95.7% | 1093.1322 | 1093.2218 | 1 | 5.265 | 87.5% | 1 | K.FDQLLAEEK.S | 22 | |
Astrin_STLC_112116_tube2_01.07603.07603.2 | 2.9021 | 0.2302 | 99.1% | 1516.3922 | 1515.6604 | 1 | 4.474 | 66.7% | 1 | K.IGQLEEQLEQEAK.E | 2 |
U | gi|62243696|ref|NP_00 | 2 | 2 | 1.8% | 1258 | 144427 | 5.6 | cohesin subunit SA-1 [Homo sapiens] &IC SCC3 |
U | gi|767925496|ref|XP_0 | 2 | 2 | 2.2% | 1032 | 119002 | 5.5 | PREDICTED: cohesin subunit SA-1 isoform X2 [Homo sapiens] &IC SCC3 |
U | gi|767925492|ref|XP_0 | 2 | 2 | 2.1% | 1121 | 129413 | 5.4 | PREDICTED: cohesin subunit SA-1 isoform X1 [Homo sapiens] &IC SCC3 |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_01.14646.14646.2 | 3.696 | 0.2383 | 100.0% | 2670.3523 | 2670.0378 | 1 | 5.014 | 40.9% | 1 | K.TLILSLQQLFNELVQEQGPNLDR.T | 2 | |
Astrin_STLC_112116_01.14634.14634.3 | 4.5808 | 0.3311 | 99.8% | 2671.1343 | 2670.0378 | 7 | 6.287 | 29.5% | 1 | K.TLILSLQQLFNELVQEQGPNLDR.T | 3 |
U | gi|58530840|ref|NP_00 | 4 | 4 | 1.6% | 2871 | 331774 | 6.8 | desmoplakin isoform I [Homo sapiens] |
U | gi|975830145|ref|NP_0 | 4 | 4 | 1.9% | 2428 | 278914 | 7.0 | desmoplakin isoform Ia [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.07000.07000.2 | 2.6896 | 0.3081 | 100.0% | 1158.3522 | 1159.3892 | 1 | 5.655 | 87.5% | 1 | R.LLQLQEQMR.A | 2 | |
Astrin_STLC_112116_tube2_01.06787.06787.2 | 2.7651 | 0.232 | 99.3% | 1271.7922 | 1272.4471 | 10 | 4.98 | 60.0% | 1 | R.QLQNIIQATSR.E | 2 | |
Astrin_STLC_112116_tube2_01.07163.07163.2 | 3.0494 | 0.4288 | 100.0% | 1388.0521 | 1388.5205 | 1 | 6.571 | 77.3% | 1 | R.LNDSILQATEQR.R | 2 | |
Astrin_STLC_112116_tube2_02.08794.08794.2 | 3.0284 | 0.3827 | 100.0% | 1538.8121 | 1539.8125 | 1 | 6.598 | 60.7% | 1 | R.LLEAQIATGGIIDPK.E | 2 |
U | gi|40217847|ref|NP_05 | 2 | 2 | 1.6% | 2136 | 244505 | 6.1 | U5 small nuclear ribonucleoprotein 200 kDa helicase [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Astrin_STLC_112116_01.14600.14600.3 | 3.7239 | 0.4431 | 100.0% | 2151.6843 | 2151.424 | 1 | 7.019 | 36.1% | 1 | R.ETYEVLLSFIQAALGDQPR.D | 3 |
* | Astrin_STLC_112116_01.12915.12915.2 | 2.6676 | 0.2509 | 98.7% | 1715.4922 | 1717.0361 | 2 | 5.304 | 53.6% | 1 | R.WTELGALDILQMLGR.A | 2 |
U | gi|525507390|ref|NP_1 | 2 | 3 | 0.7% | 5088 | 555666 | 5.6 | epiplakin [Homo sapiens] |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Astrin_STLC_112116_tube2_01.06648.06648.2 | 1.9692 | 0.3195 | 98.2% | 1162.2122 | 1161.2311 | 3 | 5.458 | 68.8% | 1 | C.GYFDEEMNR.I | 22 | |
* | Astrin_STLC_112116_01.14277.14277.3 | 4.8782 | 0.4053 | 100.0% | 2515.4043 | 2514.8386 | 1 | 7.229 | 36.5% | 2 | R.AGTLTVEELGATLTSLLAQAQAQAR.A | 3 |
Proteins | Peptide IDs | Spectra | |
Unfiltered | 44638 | 75168 | 154835 |
Filtered | 160 | 1050 | 2627 |
Forward matches | 159 | 1048 | 2625 |
Decoy matches | 1 | 2 | 2 |
Forward FP rate | 0.63% | 0.19% | 0.08% |